CAZyme Information: MGYG000003417_02256

Basic Information

• Species: Firm-11 sp004556545
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11; Firm-11 sp004556545
• CAZyme ID: MGYG000003417_02256
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439	MGYG000003417_205|CGC3	49799.95	5.7895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003417	3316884	MAG	Fiji	Oceania

• Gene Location: Start: 36230; End: 37549 Strand: +

Full Sequence      

MKKFAFIGAGSYIFTRNLVRDLFTFPAFEDCHIALMDINPLRLEKITACVNKINAAFGNK
ATVTSTMNRAEALEGADGVVCTVFNGDIDIWRYDIEIPKEYGVDINVGDTRSVSGIFRAL
RNIPLMLDICRDIEKHCPKAVFLNYTNPMSMLCKAMQANTKVEVTGLCHSVQGTAKMLAE
WIGAQPEDMTYTCAGVNHQAFYIDLRCKGEDAYPLLRKVLENPEIWNKEQVRNEMFRHLD
YYPTESSGHNSEYNAWFRKRPDLIEKYCTHGTGWNPGEYAYSLNLRLEREKTWVKELDQW
INEAEVDKNHSGEYASNIFNARFGDGKLFKFNGNVLNKHLIDNLPENCCVEVPVLASQYG
MEPIHVGPLPDHLAILVGTTARIEDMVAEAAVTGDRRKVFQAVCMDPLCSAVCSLQEIKE
MTDALFEKNKEYLPAFHRS

Enzyme Prediction     

No EC number prediction in MGYG000003417_02256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	3	181	8e-58	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	0.0	1	437	1	431	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	1.29e-178	3	426	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	7.69e-125	1	439	1	442	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05296	GH4_P_beta_glucosidase	1.53e-60	3	433	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam02056	Glyco_hydro_4	2.05e-47	3	180	1	179	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96821.1	1.19e-222	1	436	1	436
ANE45532.1	1.02e-211	1	436	1	436
QHT62813.1	3.14e-211	1	436	1	435
AEF82979.1	5.33e-211	1	436	1	437
QHT59435.1	7.83e-207	3	436	4	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	1.92e-36	3	438	6	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3FEF_A	6.37e-34	3	408	7	420	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	8.76e-34	3	438	9	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	6.99e-31	3	433	5	478	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
3U95_A	2.47e-26	3	407	2	439	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06720	2.91e-95	3	438	6	451	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	5.12e-93	3	438	6	450	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
O34645	2.15e-83	1	436	1	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9X4Y0	7.08e-80	3	436	5	442	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
D3T426	9.78e-40	3	433	12	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003417_02256.