CAZyme Information: MGYG000003410_00368

Basic Information

• Species: UBA10281 sp900554485
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900554485
• CAZyme ID: MGYG000003410_00368
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000003410_18|CGC1	91890.04	5.2365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003410	1706385	MAG	Fiji	Oceania

• Gene Location: Start: 24371; End: 26833 Strand: -

Full Sequence      

MIKITEIKTDGEQFAIGVISAPLFQWKFNGNNQTAFALGVASSEEKSLKGEYDMLDAKGG
NDTFFRYNGKPFASGKRYYATLKVSDGETSDERKFCFQTALAPEDWKGDWVNLPVNSQGG
SSLYRLRVSVDKPVKIATAYIAGIGYNEFFVNGKKVGDEVLSPATSDFTKRIYYNIYDVS
SILQPGDNVFGIEVAHGWLGAKRMLMQVNVTYTDGSETEFHSAVGCGWWVRGGAVRENSI
YDGEVYDARVEDEFAPHWASREFEPTWENGWMYTVFATVDKKLLQPQTINPIRVCDEYAP
VSTRKSGDKLIVDFGANIAGWAEIEVEGERGASVTIKYGERLDDNGEVNRLNLRSAKATD
VYILSGKSTEKWHPRFTYHGFQYAEVTFCGKVELKKIVAKHVHTDTPIIGGFGCSDETLN
YLHKIAVRTEHNNEHSILTDCPQRDERFGWLNDLGARLYQTAYNCDMSRFFPKFTGDITD
TQLSGGQIGDTAPFYTGGRPADPVCVAYLMMPYLSYKLYGDDAPAKKEYPNHKKWVDFLL
SSSDDGIMNYSYYADWVYPICFGVVADKIYVSTVSLYWHLLFMTSIAKIAGNAADEKYYA
EKAENLKKTINSHYYNANTKNYAGGTQTENSMALTLGIAPESDRKAIAENVAKDVIARNY
HSTCGNVGYRHLFYVLGEFGYADVAVKMLKNPEFPGWGYMVANGATSVWERWESEMSNEM
DSFDHPMFGSYDAFFYAFLGGITVADDACACDKVYIKPVTAGLDSVDCYYDSVRGRIKSS
WRKSGDKTVYHVEVPYGVTAEFSAGNVNKTLTYGVYDFEA

Enzyme Prediction     

No EC number prediction in MGYG000003410_00368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	303	802	1.3e-140	0.9900793650793651
CBM67	117	265	4.9e-20	0.8352272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.78e-91	410	737	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	5.12e-39	132	294	1	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.85e-34	303	403	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.60e-10	753	801	11	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	5.11e-173	19	795	50	842
QEC51112.1	6.91e-169	2	800	69	891
VEH16339.1	3.95e-165	1	814	31	864
AHF90970.1	3.71e-156	21	800	26	840
AEF82974.1	3.59e-144	22	796	31	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.10e-126	22	801	51	895	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.33e-92	108	801	290	991	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.22e-84	2	785	2	820	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.57e-96	21	800	50	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	4.22e-91	108	801	290	991	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	6.76e-80	9	809	41	883	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.22e-75	20	802	49	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003410_00368.