CAZyme Information: MGYG000003405_00610

Basic Information

• Species: Leuconostoc citreum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Leuconostoc; Leuconostoc citreum
• CAZyme ID: MGYG000003405_00610
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	MGYG000003405_7|CGC2	55840.3	4.5822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003405	1610057	MAG	United States	North America

• Gene Location: Start: 94377; End: 95861 Strand: +

Full Sequence      

MMTKKGLQLPSDFLWGGAIAAHQAEGYWDADGKGVSIADVLTAGSHEKPREITDGVLPDK
NYPNHHGIYFYKTYKEDLALMAEMGFKAFRTSIAWTRIFPNGDDAEPNEAGLKFYDDMFD
TMHELGIEPVITLNHFEMPYHLVTAYGGWQNRQVIDFFEKYARVVFERYRNKVTYWITHN
EISNQANQAEINGFSDFLVWTNSGLKFDAETTVSERQAAMYQAAHNELVASARAVRIGHE
INPDFQIGAMLNVGSLYPASTKPADQLAVQKARQQRDWFSDVHIRGAYPNEMEKLFERTG
WRSDVTDQDFIDLASGTVDYLSISYYASSVIRAKQDDDSELDEAANWETVPNTNIKASDW
GWSIDPQGLRYTLNELNDLYPDLPIMIVENGFGAYDELVEANGQPTVNDDYRIAYLAAHI
AEVEKAIVHDGIPVIGYLSWGPIDIVSAGTGEMKKRYGYVYVDLDDFGEGSAKRYKKASF
KWYQELIASGGTRL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	490	2.6e-147	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	9	494	4	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	0.0	5	494	2	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	7	491	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	1.08e-174	8	494	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	2.09e-168	9	494	6	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA36062.1	0.0	1	494	1	494
QOG09797.1	0.0	1	494	1	494
ACA81959.1	0.0	1	494	1	494
QOY97832.1	0.0	1	494	1	494
QQE98265.1	0.0	1	494	1	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	1.39e-199	8	491	6	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.96e-199	8	491	6	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.15e-193	8	491	6	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	1.51e-179	3	494	5	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	5.30e-177	2	494	1	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	2.90e-176	9	494	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	2.90e-176	2	494	1	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	5.54e-152	7	494	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.76e-151	2	494	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	5.37e-145	10	494	6	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999952	0.000091	0.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003405_00610.