CAZyme Information: MGYG000003403_00854

Basic Information

• Species: Stenotrophomonas maltophilia_AM
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AM
• CAZyme ID: MGYG000003403_00854
• CAZy Family: GT4
• CAZyme Description: N-acetyl-alpha-D-glucosaminyl L-malate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000003403_6|CGC2	40014.44	10.8906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003403	4562306	MAG	United States	North America

• Gene Location: Start: 13675; End: 14790 Strand: -

Full Sequence      

MRRLTVVQLLPALHSGGVERSTLEIAAALVAAGHRALVVSAGGRLVQPLLDSGAEHLTLD
IGRKSLLTLRHLPTLRRLFAEVGADIVHARSRLPAWLGLYAIRAMPVAQRPHWVTTVHGL
NSPSRYSAVMTSGERVICVSNSVRDYVQRHYPTVPEAKLQVIPRGVDVAQFPRVARADRR
PRLALAADYPWLAQVEGPLLLLPGRGTRLKGHVHALQLLADVRAAGVPAQLWMLGTDEPG
REAYVADLRRQAAVLGVTDAVQISTPTARIAQAYAASDLVLQLSDKPEAFGRTVVEALSV
GRPVLGWDHGGVGELLRQLQPTGAVPLGDARALGERALALLAQPPSLPTRIPFTLQAMQR
DTLRLYADLAG

Enzyme Prediction     

No EC number prediction in MGYG000003403_00854.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	196	344	3.8e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03819	GT4_WavL-like	5.50e-52	6	345	1	323	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03801	GT4_PimA-like	4.62e-34	14	345	12	335	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	5.98e-30	2	371	1	379	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	8.44e-29	6	345	2	330	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03808	GT4_CapM-like	1.34e-24	12	347	6	332	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPX95165.1	8.49e-265	1	371	1	371
QGL94340.1	8.49e-265	1	371	1	371
VEE54374.1	2.00e-263	1	371	1	371
QHE22432.1	2.72e-261	1	371	1	371
QDY50683.1	1.11e-260	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MI0_A	1.09e-36	3	369	20	392	ChainA, Glycosyltransferase [Rickettsia africae ESF-5]
4XSO_A	9.99e-08	240	316	246	322	ChainA, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSO_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSP_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSR_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_A Chain A, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418],4XSU_B Chain B, Alr3699 protein [Nostoc sp. PCC 7120 = FACHB-418]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6WPK3	3.30e-07	85	347	106	376	D-inositol 3-phosphate glycosyltransferase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / JCM 3225 / NBRC 14064 / NCIMB 13271 / NRRL B-12336 / IMRU 3971 / 101) OX=446462 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999899	0.000155	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003403_00854.