CAZyme Information: MGYG000003402_00014

Basic Information

• Species: Paenibacillus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lactis
• CAZyme ID: MGYG000003402_00014
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000003402_8|CGC1	98032.78	5.3223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003402	5924245	MAG	United States	North America

• Gene Location: Start: 893; End: 3460 Strand: +

Full Sequence      

MNPRQMVLKDWIFKAEDGQDWLPAEVPGCIHTDLYRNGRIPDPFYGTNEHDLQWIDKRNW
EYRTAFTIPEGWESESRLELVFDGLDTYADVYFNEQPVLKADNMFRSWRVDVKPYLVSGD
NEVRVVFRSPVHEDLPKLRELGYALPAANDQSALGGLGDDKISVFARKAPYHYGWDWGPR
FVTSGIWRPCRIEAWSGIRIHSLFIRQDEVTSSLARLTASVCVETESAKDAVLALATAGH
RWELPVKLAPGIQDIEFPVTIAEPKLWWSRGLGEPHLYEFNAELICEGNIEPQAAAAVRT
GLRSVRLVREPDSIGTSFYIELNGTPVFAKGANHIPNDTFLPSVTKERYRHELASAAEAN
MNMLRIWGGGIYEEDIFYELCDELGIMVWQDFMFACSMYPGDDHFRSSVRQEARENVIRL
RNHPSIVLWCGNNEIDIAWAHYNENAGWGWKRAFTPELRDKIWADYEAIFHEILPETLAE
YAPGALYWPSSPLVSLSRDEHQHANPRRTSGDIHYWGVWHNNEPFDNYNVYVGRFMSEYG
FQSFPEPKTVQMYADENSRHLESKIMSAHQKHKTGNQLIKSYMERYTKEPRNFDSFLYLS
QMQQAAAMKTAIEAHRSRKPYCMGTLYWQMNDCWPVASWSGIDYFGRWKAMHYAAKRCFR
DVSLIIKQSDDKLSVHLVSDLSVSQSGTLLIRLFNFNGEELFSQSIPIQAEPQASKILYQ
TSAGELLADHDPAAVVLRAELVQNGTLLDRKDHFFREDKELKLEDPVLSITELSGSSGTM
FIVECRKLARWVWLSTEQEGVFSDNFFELIPGISQTVTFLQRPAGKTAFFPASPGSVTIR
SLADCILLQPMEVNE

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	722	1.1e-114	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.88e-130	10	823	18	793	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	2.32e-19	671	760	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.38e-16	765	844	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	7.61e-14	13	434	63	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	8.64e-12	55	436	58	419	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB42796.1	0.0	1	846	1	844
SMF89910.1	0.0	7	846	5	844
ACX63524.1	0.0	1	846	1	844
AYB46050.1	0.0	1	846	1	844
QOT08284.1	0.0	1	846	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.51e-223	11	812	15	809	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	3.74e-223	11	812	17	811	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	3.86e-223	11	812	17	811	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.02e-222	11	812	15	809	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	4.46e-221	11	812	15	809	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	6.84e-132	4	818	6	825	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	5.83e-130	9	818	11	827	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	2.25e-129	9	818	11	827	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q2TXB7	4.31e-129	11	825	13	833	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.19e-128	11	825	13	833	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003402_00014.