CAZyme Information: MGYG000003401_02030

Basic Information

• Species: Staphylococcus capitis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus capitis
• CAZyme ID: MGYG000003401_02030
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259	MGYG000003401_29|CGC4	27731.32	4.17

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003401	2394594	MAG	United States	North America

• Gene Location: Start: 162761; End: 163540 Strand: +

Full Sequence      

MKKTLTVTLSSIAAFFAINTAANAQESEASQQDVNSPDVVTTNQSNLGTYIVKAGDCLYN
IAVEHGITLEQLYTLNPGIQPLIFPGDKIVVSESGVNPSQFESEEISIPQTTFESTSTDE
SGVTYENYETPINFSQTSYDGLRSISNAGNLYTDGQCTYYAFNRRAELGKPIGSLWGNAS
NWAASASQAGFNVNNTPEVGAIFQSAPGQNGAGAYGHVGVVESVNPNGTLTVSEMNWNGG
VNVKSYRTIYNPGSYNYIH

Enzyme Prediction     

No EC number prediction in MGYG000003401_02030.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	6.93e-34	144	259	60	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
pfam05257	CHAP	5.70e-22	149	236	2	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
PRK08581	PRK08581	6.66e-21	152	249	508	605	amidase domain-containing protein.
cd00118	LysM	4.23e-11	49	91	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	5.90e-09	49	91	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATN03348.1	1.98e-184	1	259	1	259
QOX61327.1	1.98e-184	1	259	1	259
BAW91442.1	1.98e-184	1	259	1	259
AKL91273.1	1.62e-183	1	259	1	259
QKH91643.1	1.87e-173	1	259	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2LRJ_A	3.63e-34	144	259	3	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
2K3A_A	7.62e-32	148	259	48	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
5T1Q_A	4.29e-13	135	249	232	345	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G278	2.42e-67	1	259	1	279	Probable autolysin LDP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00773 PE=1 SV=1
Q6GJK9	1.20e-33	41	259	151	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q5HIL2	4.58e-33	41	259	151	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain COL) OX=93062 GN=sle1 PE=3 SV=1
P0C1U7	4.58e-33	41	259	151	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus OX=1280 GN=sle1 PE=3 SV=1
Q6GC24	4.58e-33	41	259	151	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.998976	0.000181	0.000206	0.000188	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003401_02030.