CAZyme Information: MGYG000003400_01216

Basic Information

• Species: Stenotrophomonas sp003028475
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas sp003028475
• CAZyme ID: MGYG000003400_01216
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1119	MGYG000003400_21|CGC2	123556.35	6.333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003400	4365701	MAG	United States	North America

• Gene Location: Start: 8206; End: 11565 Strand: +

Full Sequence      

MENCVRRSPLLLALLPALMLASTSGRAEPVGNLRSVSTSDNRDGVRGWDLQTDSGARIRI
ELPAADIIRVQAGRNGKLTGAGDKAAPIVLPQPRANVQVQLEEDAQEMRVRTDALVLHVQ
RQPLRLRLERLDNGQPTALWQELQPLDLDATQSVQVLSSQADEGYYGGGQQNGRYQFKGR
ELEVSYSGGWEEGDRPSPAPMLLSSRGWGMLRNTWSDGSYDLRQSDQATLLHREDRFDAY
YFVGADLPKLIERYTQLTGRPNMVARWALSYGDADCYNDGDNSKKPGTVPEGWSDGPTGT
TPDVIDSVAKQYRAHDMPGGWILPNDGYGCGYKQLPETVKGLAGYGFRTGLWTENGVDKI
AWEVGKAGSRVQKLDVAWTGKGYQFAMDANRQAFNGILDNSDSRPFLWTVMGWAGIQRYA
VAWTGDQSSSWDYIRWHVPTLVGSGLSGMAYASGDVDAIFGGSAETFTRDLQWKAFTPVL
MGMSGWSSNARKHPWWYDEPYRSINRDYLKLKMRLTPYMYGLVHDAAQTGAPPVRGLMWD
NPRDPHAQDETYKYQFLLGRDLLVAPVYRSQAASRGWRRDIHLPAGGWIDYWDGRRVQAG
ADGRQLDRQVDLATLPVFVRAGAILPMYPSMLFDGEKPLDEVTFDLYPQGDSQYTLYEDD
GNTRRYQQGESSTQRIRVQAPAQGSGPVQVQIDAVQGQYNGQLAQRRYGLRVLSRQAPRA
VQAAGRALPALADAAAFNGAAEGWYFDAAERRGTLHVRTASQDIRQPLQLQLDFAVAAAT
ADDAYPAAPVLGRELPADSLLVVNRPAEEPGHALENAFDDDPGTWFRSVRNQAVRTGAHE
WVIGFGERKMIDGIDIAPRNDKNWKHGQVRDYEVYLGDSNGEWGEPIARGRLQLKEGVQR
IDFPAHAGRLLRFRVLSVQNPEGDGASSTDPMVTAAQGSARAFDALQPRDVGPIALSTFH
ILEHQEPERPARQRYLSELPVPAALASQVRADQSFRGDAGMRMNGLQFRRGLGVGANSRI
DLRLQGGWHLLRADLGIDDACRNAGGLQFQVWGDNRLLYDSGLVKAPGVVKPELDIRGLS
RLSLRTLGAQGSQPAQVCANWANAVLIGQEGDSASIVAP

Enzyme Prediction     

No EC number prediction in MGYG000003400_01216.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	386	625	4.7e-65	0.5386416861826698
CBM51	975	1106	1e-27	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	0.0	257	594	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	3.57e-73	197	691	192	737	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.52e-61	240	625	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	5.56e-44	394	663	201	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06604	GH31_glucosidase_II_MalA	1.72e-29	385	530	193	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI09434.1	0.0	1	1119	1	1119
QGL98835.1	0.0	1	1119	1	1119
BCX45776.1	0.0	1	1119	1	1119
ARZ76289.1	0.0	1	1119	1	1119
QDL29876.1	0.0	1	1119	1	1119

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	1.36e-104	131	723	141	787	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	6.82e-104	131	723	141	787	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	1.80e-103	131	723	141	787	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR6_A	3.74e-41	54	728	49	791	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	8.71e-41	54	728	49	791	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9P999	7.32e-39	200	670	153	667	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9F234	1.42e-38	383	679	442	729	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
B3PEE6	1.24e-26	47	661	47	711	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
B9F676	1.02e-25	382	669	544	824	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
P79403	1.39e-25	404	669	596	857	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000525	0.998466	0.000319	0.000301	0.000201	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003400_01216.