CAZyme Information: MGYG000003390_02707

Basic Information

• Species: Pseudescherichia vulneris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pseudescherichia; Pseudescherichia vulneris
• CAZyme ID: MGYG000003390_02707
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000003390_62|CGC1	34634.15	8.2238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003390	4956281	MAG	United States	North America

• Gene Location: Start: 142156; End: 143112 Strand: -

Full Sequence      

MLTDSRMMASAAWDAQSLNELKTQAGQDPQANLRPVARQVEGMFVQMMLKSMREALPKDG
LFSSDSTRMYTSMYDQQIAQQLTAGKGLGLAEMMVKQMSGGQSEPTEAPSQVPMKFPLET
VTSYQNQALTQMVRKAMPKTPDGGGNDAALSGDSKEFLAQLSLPARLASEQSGVPHHLIL
AQAALESGWGQRQIKRENGEPSFNLFGVKASSSWKGPTTEITTTEYENGEAKKVKAKFRV
YGSYLEALSDYVGLLSRNPRYAAVTTAATAEQGAQALQSAGYATDPNYARKLTSMIQQLK
SLSDKVSKAYSNDIENLF

Enzyme Prediction     

No EC number prediction in MGYG000003390_02707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	167	299	5e-34	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	2.54e-167	2	314	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	9.62e-130	11	300	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12712	flgJ	5.22e-75	12	301	17	344	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12709	flgJ	6.51e-73	12	299	15	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	2.09e-69	11	301	15	328	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCU48262.1	3.31e-196	1	318	1	316
QPB34059.1	3.31e-196	1	318	1	316
QDK85692.1	3.31e-196	1	318	1	316
AUZ65999.1	3.31e-196	1	318	1	316
AMG54649.1	3.31e-196	1	318	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	2.96e-99	153	318	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	6.88e-92	153	303	2	152	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	8.42e-38	168	296	15	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.10e-37	168	296	16	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	8.49e-37	168	296	16	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	1.30e-187	1	318	1	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	4.78e-180	1	318	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	1.59e-178	1	318	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9I4P4	1.25e-45	14	301	20	387	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1
Q9X9J3	2.77e-42	14	302	13	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003390_02707.