CAZyme Information: MGYG000003390_00013

Basic Information

• Species: Pseudescherichia vulneris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pseudescherichia; Pseudescherichia vulneris
• CAZyme ID: MGYG000003390_00013
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157		17197.74	9.7203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003390	4956281	MAG	United States	North America

• Gene Location: Start: 8343; End: 8816 Strand: -

Full Sequence      

MTDSKIIPILNYEEGYKESPYLDTLGYPTVAGGIRIGPKGASLSNYTFRVPRTVGDAWKQ
VIVDQKANEMSQRPSIAAAINACNPPRRDVLISMAYQMGVDGLAGFKNTLKLIADGNFIA
AADGMLNSLWAKQTPNRAKRHADVMRTGSYDIYRGLI

Enzyme Prediction     

No EC number prediction in MGYG000003390_00013.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	6.89e-65	6	151	2	145	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	3.74e-27	3	153	172	336	baseplate hub subunit and tail lysozyme; Provisional
cd00737	lyz_endolysin_autolysin	1.16e-05	14	126	9	111	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	1.98e-04	9	145	10	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	0.003	84	139	49	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXZ12060.1	2.40e-112	1	157	1	157
AIX48853.1	5.24e-107	1	157	1	157
AMG57743.1	1.53e-85	4	157	2	155
AVG76134.1	2.32e-80	4	157	2	155
CUU23126.1	2.71e-79	4	157	2	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
137L_A	1.23e-20	6	156	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4],137L_B Chain B, T4 LYSOZYME [Tequatrovirus T4]
1DYA_A	1.23e-20	6	156	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
6V51_A	1.23e-20	6	156	3	164	ChainA, Endolysin [Tequatrovirus T4]
1L22_A	1.74e-20	6	156	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
1L62_A	1.74e-20	6	156	3	164	ChainA, LYSOZYME [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00720	5.78e-18	6	156	3	164	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2
Q556F2	7.17e-17	4	154	3	170	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
P16009	2.83e-08	9	153	179	339	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003390_00013.