CAZyme Information: MGYG000003387_02980

Basic Information

• Species: Pseudomonas_R sp900766265
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_R; Pseudomonas_R sp900766265
• CAZyme ID: MGYG000003387_02980
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319	MGYG000003387_13|CGC7	36682.34	9.4886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003387	4465621	MAG	United States	North America

• Gene Location: Start: 739977; End: 740936 Strand: +

Full Sequence      

MLNILFLVQSEQRAILDRLYQAIGENSICDIRWLDKRQQSNLRRYFEQHVDVSRYDRIVF
FLRFKQEIRQAGFIRHIPNLVILEHDAYQNYIPCKYKGKFSRHYRRLPGSRILVSSAVVA
RRLQEEGFDAVFVPKGYDQALLSNLGIHRDIELGFLGSTKSQAYAGRKLLLDELAKAEKL
VVARTNSGSEYLETLNRIRFFVSADVGMGEYMIKNFEAMACGCVLLAFDQGAEENQALGF
VDMENIVLYKTVSELRAKLSILRADPGLADRIACNGQRLAESRYSFERIGAAAVEAMKPP
LRTVPPPNWLDKLRYRFGW

Enzyme Prediction     

No EC number prediction in MGYG000003387_02980.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13524	Glyco_trans_1_2	8.68e-08	213	288	14	86	Glycosyl transferases group 1.
COG0438	RfaB	1.30e-06	31	289	136	366	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	7.83e-05	32	297	121	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03825	GT4_WcaC-like	0.007	135	285	208	349	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVX15352.1	2.73e-168	2	318	1	317
AWL02371.1	2.73e-168	2	318	1	317
VEF14257.1	5.49e-168	2	318	1	317
SDU16511.1	1.42e-163	2	318	1	317
VEE14107.1	3.33e-162	2	318	1	317

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003387_02980.