CAZyme Information: MGYG000003387_02886

Basic Information

• Species: Pseudomonas_R sp900766265
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_R; Pseudomonas_R sp900766265
• CAZyme ID: MGYG000003387_02886
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
707	MGYG000003387_13|CGC5	78310.93	7.3962

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003387	4465621	MAG	United States	North America

• Gene Location: Start: 627326; End: 629449 Strand: -

Full Sequence      

MTSAPQTDQPRGPERLFVLKEGDSFLVADHFGDLGGQEDGLFRNDTRVLSRWRLRVGGQR
PALLSSAVSQDNVFFTAHLSNQPLPVLGEPDTAQGVIHIERKRLLWEGRLLEQLSLVNFA
DEPASVPLDFEFAADFRDMFEVRGQRRAHRGELLDAELGQQSVTLRYQGLDDQLRCAAIS
FSQLPGQLDEQHARFVVDLAARAKWELFVEIGQALCEPNRTRFRQAAALARRSMRRRRRR
GAQVKTSGRLFQAWLDKSRADLALLTTELPTGPYPYAGIPWFSTPFGRDAIITALQMLWL
DPSLARGVLAYLARHQAREHSSFRDSAPGKIMHETRQGEMSAVNELPFGRYYGGVDTTPL
FIVLAGAYARRTADRAFIESIWPALESAVSWMDEQAAGHPSGLLGYARGEDSGLINQGWK
DSHDSVFHADGSTPEGPIALVEVQGYAYRAYREMAELAAERGMAERAVEWGAKAERLRAA
VEQHFWLAPAGFYALALDGTGHACQVQASNAGHLLYCGLPDPERGRATAQKLLSRAFNSG
WGIRTLVPDAARYNPMSYHNGSIWPHDMALCAAGLARYGERQGVVRLLAGLFEAASHFGM
RLPELFCGFERAPGEAPIAYPVACLPQAWAAGSVFMMLQACLGISIDARQGRVRVERPQL
PAGIDHLQLRGLKVGDGMLDLSFQRLGSRTVVFADRREGPVRLTIEQ

Enzyme Prediction     

No EC number prediction in MGYG000003387_02886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	301	540	2.4e-16	0.38095238095238093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	5.69e-138	40	682	42	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam14742	GDE_N_bis	1.16e-64	19	210	1	193	N-terminal domain of (some) glycogen debranching enzymes. This domain is found on the N-terminal of some glycogen debranching enzymes and is usually followed by the GDE_C (PF06202) and in this sense it is analogous (but probably not homologous) to the GDE_N (PF12439). Its exact function is unknown
pfam06202	GDE_C	8.30e-21	270	634	16	372	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17389	Bac_rhamnosid6H	1.00e-10	347	545	89	264	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam01204	Trehalase	2.64e-06	351	494	173	358	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU29820.1	0.0	6	706	11	711
AYN97300.1	0.0	6	706	11	711
VTU32942.1	0.0	11	706	22	719
VTV10670.1	0.0	11	706	22	719
VTU35308.1	0.0	11	705	22	716

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003387_02886.