CAZyme Information: MGYG000003387_02318

Basic Information

• Species: Pseudomonas_R sp900766265
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_R; Pseudomonas_R sp900766265
• CAZyme ID: MGYG000003387_02318
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		37743.15	6.071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003387	4465621	MAG	United States	North America

• Gene Location: Start: 14766; End: 15791 Strand: +

Full Sequence      

MRKSLLALLLVAVGGLAQAAVQLKDGHPERYTVVKGDTLWDISGRFLREPWKWPELWHAN
PQIENPHLIYPGDTLSLVYIDGQPRLTLDRGASRGTIKLSPRIRSTPMAEAIPTIPLEAI
NSFLLKNRIIDSPAEFQGAPYIVAGNAERVISGSGDRIYGRGQFQEDLPAYGIFRQGKTY
TDPETKEFLGINADDVGGAEIVDIEGDIATLHLLRTNQEVRLGDRLFPTEERAVNSTFMP
KAPEAEIKGVILDVPRGVTQIGQFDVVTLNKGARDGLEEGHVLAVYKTGETVRDRVTGEY
VKIPDERAGLLMVFRAYDKLSYGLVLQATRSLSVMDKVRNP

Enzyme Prediction     

No EC number prediction in MGYG000003387_02318.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1652	XkdP	6.90e-11	18	172	71	230	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	6.39e-09	31	77	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	1.47e-08	18	77	199	261	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
COG1652	XkdP	5.52e-08	65	327	2	260	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
TIGR02899	spore_safA	9.08e-08	33	77	1	42	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI29645.1	7.19e-219	1	341	1	341
AFM31302.1	7.19e-219	1	341	1	341
AWT12158.1	5.90e-218	1	341	1	341
QTF56975.1	8.38e-218	1	341	1	341
QFU10403.1	1.19e-217	1	341	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	1.94e-199	1	341	1	341	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]
3JC8_Ta	3.06e-25	29	337	79	398	ChainTa, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tb Chain Tb, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tc Chain Tc, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Td Chain Td, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Te Chain Te, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tf Chain Tf, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tg Chain Tg, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Th Chain Th, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Ti Chain Ti, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tj Chain Tj, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tk Chain Tk, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tl Chain Tl, LysM domain protein [Myxococcus xanthus DK 1622],3JC9_Ta Chain Ta, TsaP [Myxococcus xanthus DK 1622],3JC9_Tb Chain Tb, TsaP [Myxococcus xanthus DK 1622],3JC9_Tc Chain Tc, TsaP [Myxococcus xanthus DK 1622],3JC9_Td Chain Td, TsaP [Myxococcus xanthus DK 1622],3JC9_Te Chain Te, TsaP [Myxococcus xanthus DK 1622],3JC9_Tf Chain Tf, TsaP [Myxococcus xanthus DK 1622],3JC9_Tg Chain Tg, TsaP [Myxococcus xanthus DK 1622],3JC9_Th Chain Th, TsaP [Myxococcus xanthus DK 1622],3JC9_Ti Chain Ti, TsaP [Myxococcus xanthus DK 1622],3JC9_Tj Chain Tj, TsaP [Myxococcus xanthus DK 1622],3JC9_Tk Chain Tk, TsaP [Myxococcus xanthus DK 1622],3JC9_Tl Chain Tl, TsaP [Myxococcus xanthus DK 1622]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54335	5.87e-07	28	77	158	217	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2
P45932	1.94e-06	28	77	158	217	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999067	0.000181	0.000167	0.000165	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003387_02318.