CAZyme Information: MGYG000003383_01932

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_01932
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000003383_26|CGC2	83103.13	4.6289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 81486; End: 83792 Strand: +

Full Sequence      

MGTIEELDLLNSDIDDIYLGNLGTVDADLNLPNTGKRGSAFAWSSGERLFLSDAGKVTRP
TFGVGDRDVQLYLTASYGGSTEEREYTVTVLQEQPQTTIVAVDDVRVVAFAGQPAELPSV
AVVHLSDGSSEVRPVTWDRTASAGDDAASGAIEGDVSVATGHVEGWGAPVEAKADVVFAH
PDVRDRERAQASRENFVRSHARFDGDGVLGRKVAARLEFLRNVDEGRMLYNFRQAAGLDV
QGAAPMTGWDSPEGNLRGHTTGHFLSALALAYDCTGDKVILAKIGRMVEALAECQQALHE
SKGYSWGFLSGYSEEQFDLLEEYVTYPTIWAPYYTFDKIVSGLLDCYEYAGSDQALGIAL
KMGFWANRRLGRLTKPQRDRMWSIYIAGEYGGIISALIRLYRITGDSRFVTTAGYFHNDK
LLYPMGRGVDTLGGMHANQHIPQIIGALDCATYGGDLDGLRIACNFWNIVTDRHMYAIGG
VGETEMFRAPDAIAAYLTDKSAESCATYNLSKLAMKLFETAPDASYADYYEHALLNDLVP
ATHSEVDGGTVYFFPTRPGGRLSFDTDANTCCHATGFENMFRFEEHIVKGTADTAYVNLY
IPAEVEACGGALRCRIGHEGGLRYSIEVLKADDVRILLRRPAWTTSMAVSVNGSPAMTHD
TAVHGYVTTDRPLAAGDTVTVEFGAGLRLLPAPDDASVAALAWGPYVLAAASDSEEFLTV
SRAALDGAFAETTLDGALKSLTAAAGVPFMALSEVNDGRYHVYVRVAA

Enzyme Prediction     

No EC number prediction in MGYG000003383_01932.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	206	709	1.4e-148	0.9880715705765407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.69e-107	206	709	6	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.88e-71	205	718	15	510	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07532	Big_4	2.79e-05	112	165	11	58	Bacterial Ig-like domain (group 4). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in a variety of bacterial surface proteins.
cd04792	LanM-like	4.94e-05	342	413	600	676	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AET60941.1	5.70e-210	1	767	8	766
ASA19572.1	2.92e-207	17	767	24	766
ASR47498.1	6.44e-207	1	766	8	765
ADK83263.1	1.63e-191	5	763	9	754
QRT48731.1	2.72e-188	8	763	5	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.97e-54	217	736	48	579	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	7.51e-51	217	736	48	579	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.38e-11	368	683	161	530	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	7.18e-11	368	683	161	530	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003383_01932.