CAZyme Information: MGYG000003383_00375

Basic Information

• Species: Bifidobacterium scardovii
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium scardovii
• CAZyme ID: MGYG000003383_00375
• CAZy Family: GH3
• CAZyme Description: Exo-alpha-(1->6)-L-arabinopyranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000003383_10|CGC3	80447.46	4.4115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003383	3123324	MAG	United States	North America

• Gene Location: Start: 162566; End: 164824 Strand: +

Full Sequence      

MSESTYPSVKDLTLEEKASLTSGGDAWHLQGVESKGIPGYMITDGPHGLRKSLASSAGET
DLDASVPATCFPPAAGLSSSWNPELIRKVGEAMGEECIQEKVAVILGPGVNIKRNPLGGR
CFEYWSEDPYLAGHEAIGIVEGVQSKGVGTSLKHFAANNQETDRLRISANIGPRALREIY
LPAFEHIVKTAQPWTVMCSYNRINGVYSAQNRWLLTDVLRGEWGFEGIVMSDWGADHDRV
ASLNAGLNLEMPPSYTDDEIVHAARDGRIAPAQLDAMAQGMIDLVNRTRAAMSVDDYRFD
VDAHDEVAHQAAVESIVMLKNDGAILPLDADAASGQKIAVIGEFARTPRYQGGGSSHITP
TRMTSFLDVLDERGIAAEFAPGFTLDLEPADPALETQAVDAAKRADTVLMFLGLPEAAES
EGFDRETLDIPAKQIALLDAVAAANDQVVVVLSNGSAVSVAPWAGRAKGILESWLLGQAG
GPALADVIFGRTSPSGKLAQTIPMDINDDPSMVNWPGEEGHVDYGEGVFVGYRYYDTYGK
AVGYPFGYGLSYATFEISKAAVARTGANTAVVTATVTNTSGVDGAETVQVYVAPGKADVA
RPRHELKGFVKVFLKAGESADVAIDLDERAFAYWSERYDDWHIESGEYAVEIGTSSRDIA
ATVTVALEGDGKTQPLTAWSTYGEWSSDPIGAKVMAAVAAAGEAGELPKLPDNAMMNMFL
MAMPINSLPTLMSEGGKSITRFMLDEYARLTK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	252	6.1e-67	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.43e-93	69	659	118	757	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	1.46e-66	316	532	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	3.97e-64	24	345	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.57e-57	9	627	57	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.02e-37	36	279	65	311	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ32045.1	0.0	1	752	1	752
ACV66984.1	0.0	1	752	1	752
BAR00513.1	0.0	1	752	1	757
VEG22218.1	0.0	1	752	1	757
AYZ89384.1	0.0	1	752	1	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WAB_A	0.0	1	752	1	748	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	1.32e-210	9	728	9	731	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	4.40e-125	9	675	8	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.69e-124	9	675	8	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.69e-105	9	668	10	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E7CY69	0.0	1	752	1	757	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	0.0	1	752	1	757	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P14002	5.09e-210	9	746	9	746	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	1.18e-122	12	675	9	818	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A7LXS8	9.81e-119	12	664	53	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996265	0.003748	0.000007	0.000004	0.000003	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003383_00375.