CAZyme Information: MGYG000003382_01907

Basic Information

• Species: Pantoea agglomerans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea agglomerans
• CAZyme ID: MGYG000003382_01907
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000003382_19|CGC3	55832.91	6.3784

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003382	4723531	MAG	United States	North America

• Gene Location: Start: 66325; End: 67752 Strand: +

Full Sequence      

MSRQTVHIPENFILGAAASAWQTEGWSGKKAGQDSWPDAWYQQDRHVWHNGYGPAVATDF
INRFSEDVALMKASGLTHYRTSINWSRFLIDYETATVDEEYAAYYDRLIDEMQRQGIELM
LCLEHYELPATLLEQYGGWQSKHVVELFIRYVEQVFKRYAGRVTRWFVFNEPIVVQTRVY
LDALRWPYEQNTHKWMQWNHHKNLATARVVQLFRAAGYAGRIGTILNPEVTYPRSSAPHD
QKAAHIYDLFYNRVFLDPAIKGEYPAELLALLDKHQIEWETTPEELAIIAANTVDEVGLN
LYYPHRVKAPSRAWHPGTPFHPAWYYEHFELPGRRMNPSRGWEIQPEIIWDMAQRMRDEY
GNIPWFVAESGMGIENEAQFKNADGEIQDDYRIAFISEHLHQAIRASQAGINCQGYMLWA
FTDNVSPMNAFKNRYGLIEIDLDKQRQRRMKKSAHWFRTLRDTQQFTLWLDDEPK

Enzyme Prediction     

No EC number prediction in MGYG000003382_01907.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	463	9.7e-115	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	6.69e-149	9	458	5	447	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	4.68e-105	9	466	6	453	Glycosyl hydrolase family 1.
PRK09589	celA	9.53e-59	8	458	4	466	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	9.06e-54	9	458	5	463	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	1.46e-50	8	458	6	467	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTC51278.1	0.0	1	475	1	475
QIA52523.1	0.0	1	475	1	475
QAV50585.1	0.0	1	475	1	475
QAV45745.1	0.0	1	475	1	475
QGY57070.1	0.0	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	7.02e-131	9	458	4	453	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	4.11e-130	9	458	5	454	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	2.03e-121	6	460	18	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	5.73e-121	6	460	18	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	5.88e-77	4	458	7	442	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.68e-122	9	458	10	457	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
Q97EZ2	1.78e-60	10	460	6	460	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1
B3W7I3	9.52e-60	1	463	1	469	6-phospho-beta-galactosidase OS=Lacticaseibacillus casei (strain BL23) OX=543734 GN=lacG PE=3 SV=1
P14696	1.33e-59	1	463	1	469	6-phospho-beta-galactosidase OS=Lactobacillus casei OX=1582 GN=lacG PE=3 SV=1
P26208	2.78e-59	6	458	4	440	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999750	0.000288	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003382_01907.