CAZyme Information: MGYG000003381_00580

Basic Information

• Species: Lachnoanaerobaculum sp000296385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoanaerobaculum; Lachnoanaerobaculum sp000296385
• CAZyme ID: MGYG000003381_00580
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000003381_58|CGC1	45174.61	5.1392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003381	2661892	MAG	United States	North America

• Gene Location: Start: 7689; End: 8840 Strand: +

Full Sequence      

MVKKEKYILLDKYIDFLLENSDASSPMWNIEQIRSGRKNKWNYIDACMISAYLELYEIKR
DKKYLNFCDDFVSAFVNEDGSINTYDIEEYNIDNIRPGKNLFKLFELTGKKKYRKAMDTV
YSQLKTMPRTDEGNFWHKKIYPYQVWLDGLYMAQPFYMEYETKYNRMRFCIDSFSQFENV
ERIMKDTNTGLYYHGYDESRQSLWCDKKTGLSKNFWLRSIGWFILSLVDTALAIDESLYY
EFRRLQEMLYNLANDLLKFQDESGMFYQLVDRKDDKDNYLETSGSALISYAFLKAVRNKL
LPKRFEDIGKKIFDGILDRYLCVEGEELSLGGICLVAGLGGKENRDGSAEYYYSEPVVKN
EAKGVAPLLMAYTEIIRLGMAYD

Enzyme Prediction     

No EC number prediction in MGYG000003381_00580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	377	1.5e-105	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.68e-90	38	378	31	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.52e-78	31	378	17	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35233.1	3.10e-194	1	377	1	378
ADZ83101.1	2.08e-164	9	378	3	372
QEH68585.1	2.96e-164	9	378	3	372
ATP00557.1	7.71e-162	1	376	1	378
QIA43718.1	7.71e-162	1	376	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.56e-94	41	374	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.83e-55	39	375	37	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.47e-54	39	375	27	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.40e-11	91	328	108	339	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.19e-54	39	375	37	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.92e-36	152	378	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.92e-36	152	378	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	8.45e-20	41	316	29	290	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003381_00580.