CAZyme Information: MGYG000003372_03717

Basic Information

• Species: Citrobacter werkmanii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter werkmanii
• CAZyme ID: MGYG000003372_03717
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000003372_72|CGC1	34545.1	9.2751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003372	4983851	MAG	United States	North America

• Gene Location: Start: 15496; End: 16446 Strand: -

Full Sequence      

MIGDSKLLTSAAWDAQALNELKAKAGQDPAANIRPVARQVEGMFVQMMLKSMREALPKDG
VFSSDSTRLYTSMYDQQIAQQMTAGKGLGLAEMMVKQMTQGQAQPADDTPQVPMKFPLET
VTSYQNQALTQLVRKAIPRTTESNDEPLSGDSKDFLAQLSLPAKLASQQSGVPHHLILAQ
AALESGWGQRQIRRENGEPSFNIFGVKASGGWKGPTTEITTTEYENGEAKKVKARFRVYS
SYLEALSDYVGLISRNPRYAAVTAAATAEQGAQALQNAGYATDPNYARKLTSMIQQLKSM
SEKVSKTYSTNIDNLF

Enzyme Prediction     

No EC number prediction in MGYG000003372_03717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	164	297	8.5e-34	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	7.46e-169	2	312	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	1.80e-131	11	298	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12709	flgJ	2.01e-75	12	297	15	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12712	flgJ	9.14e-74	12	299	17	344	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	1.60e-70	11	299	15	328	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV31337.1	1.09e-221	1	316	1	316
QET66089.1	1.09e-221	1	316	1	316
BBV36348.1	1.09e-221	1	316	1	316
AYL65624.1	1.09e-221	1	316	1	316
AWS97375.1	1.09e-221	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	2.93e-101	151	316	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	5.22e-91	151	301	2	152	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.45e-38	163	294	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.89e-38	163	294	13	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.47e-37	163	294	13	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	2.23e-199	1	316	1	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	3.75e-188	1	316	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	1.25e-186	1	316	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9X9J3	1.33e-42	14	300	13	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	3.48e-42	14	301	13	310	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003372_03717.