CAZyme Information: MGYG000003370_01441

Basic Information

• Species: Streptococcus mitis_AC
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus mitis_AC
• CAZyme ID: MGYG000003370_01441
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1258	MGYG000003370_15|CGC1	143299.66	5.8448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003370	1846494	MAG	United States	North America

• Gene Location: Start: 91870; End: 95646 Strand: +

Full Sequence      

MRREEVLRNHWFFNQEVGKEEALASDFQRENWQVIQVPHDWSIYNDFDQYSPAQNEGGQL
NGGQAWYRTQFYLEEDASLVSVRLLFDGVYMNAQVYINGQVLGYYPNGYTPFSYDITPYL
RNDGTANQLAVFVDNQQPSSRWYSGSGIYREVELLITDLVHLDLYGIKIVSPKLKEQRQS
WVETQLESKVSNDGPQSVSVYLEQSIWYDGQQLSDWQATDSLVIESGDKYSFQQAISIFQ
PLLWDIDHPHLYQLKTRLYKNGILVNEEEETFGYRYMDWQSDKGFFLNGRWLKIHGVCLH
HDYGALGAVENRSAAERRLRQMKEMGVNAIRITHNPASSILLDLAAKMGLLIQEEAFDTW
YGGKKEYDYGRFFEEEATHPEAKAGDFWSDYDLRTMIERGKNNPAIFMWSLGNEVSEANG
DAHSLKTIKRLLERVKEVDDSRFVTMGMDQFRFGDGSGGHEKIANFLDVVGLNYSEDNID
AIRKRHPKWRLYGSETSSATRTRDSYFRPAKEWVGDNRRVRNFEQSDYGNDRVPWGKTAT
ASWIADRNRLDYAGQFIWTGVDYIGEPTPWHNQNDTPVKSSYFGIVDTAGIPKNDYYLYQ
SQWLALDQQPMVHILPHWNWEIHKSYQQVVDKYGDIPVRVYSNAGFVELFLNGKSQGRKT
FQEKWTSDGRKYQEGEGSDQLYLEWRLAYQPGELHAVAYDRQGQIVAEDRVVTAGKPAKI
GLHAEKTKLEPDGQDLLYLYFDVLDKDGNWVPSASNQLHFKIEGPARIVGVDNGRQSSRE
RYQAQKNGRFKRKAFHGRGVLLVQSLEQAGQVRVKASARGLEPASFDILVGEALDCQPVK
NKRLFEIRVDKQAGLQEGASPAIGLYPQTVDNPVNKVGNSEVIWETSGSAHAIIKQGVLH
CLSAGDLAIQGKTYQTHLQVAENTSLGRAVSVRPLRLYTAKGTYPQFPSSILVDYEFGSA
KRVKVVWEEIPEEALARFHEFTVSGQLEGLNLKASAQVCVQGICAIEPERVWTLVKEPPH
LPDRVKLVLSDGRRDTAKVTWNELDPQVYAQVGECVLTGQVVGCELPATVTIHVTDASVD
GEVISNQWTGSNLPLVFASHSEPNHPASYLNDKVIARKKSTANTWITKSEQASVGILFGD
AGILKPRFVDNVTLYYVENQEYLAVEPSFIDYYVGNEPTLPRTPNHLDKDSLLKQEENWR
PVSAIRKVSSDKDEELRFEFDKVETYALRLRFEGLTSPLALTELQVYAKKVKKNVDRK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	752	3.9e-106	0.7287234042553191
CBM71	1082	1254	9.7e-47	0.9073170731707317

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.54e-111	1	777	9	767	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	6.52e-38	10	444	51	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam18565	Glyco_hydro2_C5	5.31e-34	720	825	1	101	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	2.04e-28	63	473	65	470	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	2.14e-24	10	155	11	166	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ11502.1	0.0	1	1258	1	1262
QBZ12533.1	0.0	1	1258	1	1262
QGS43039.1	0.0	1	1258	1	1262
QBZ14322.1	0.0	1	1258	1	1262
BBP10599.1	0.0	1	1258	1	1262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CU6_A	0.0	10	832	21	846	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	0.0	10	832	21	846	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
4YPJ_A	3.88e-236	10	828	15	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	1.24e-222	9	835	8	806	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
7NIT_A	2.69e-178	21	1215	48	1165	ChainA, Beta-galactosidase [Bifidobacterium bifidum],7NIT_B Chain B, Beta-galactosidase [Bifidobacterium bifidum],7NIT_C Chain C, Beta-galactosidase [Bifidobacterium bifidum],7NIT_D Chain D, Beta-galactosidase [Bifidobacterium bifidum],7NIT_E Chain E, Beta-galactosidase [Bifidobacterium bifidum],7NIT_F Chain F, Beta-galactosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	2.27e-172	21	832	60	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.70e-97	9	774	53	768	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.65e-46	2	761	51	767	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	2.58e-43	21	825	44	790	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	3.27e-40	21	818	21	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003370_01441.