CAZyme Information: MGYG000003365.1_03073

Basic Information

• Species: Pseudescherichia sp002298805
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pseudescherichia; Pseudescherichia sp002298805
• CAZyme ID: MGYG000003365.1_03073
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000003365.1_43|CGC1	71672.09	5.486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003365.1	4272522	MAG	United States	North America

• Gene Location: Start: 66587; End: 68545 Strand: -

Full Sequence      

MSQIHKHSVPANIAENCLINPEQYEAKYQQSVSDPETFWGEEGKILDWIRPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDAQQSKHISYRELHADVCRF
ANALLALGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGVRAGRSIPLKKNVDDALKNPNVTTIEHVVVLKRTGGNIEWQEGRDLWWSDV
MAQASSEHQPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIAGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVIDTWWQTETGG
FMIAPLPGATELKAGSATRPFFGVQPALVDNEGTPLDGATEGNLAIVDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPALYTEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQGITMPS

Enzyme Prediction     

No EC number prediction in MGYG000003365.1_03073.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0365	Acs	0.0	68	631	1	528	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism].
PRK04319	PRK04319	0.0	69	628	36	570	acetyl-CoA synthetase; Provisional
PRK00174	PRK00174	0.0	6	646	1	634	acetyl-CoA synthetase; Provisional
cd17634	ACS-like	0.0	24	611	1	587	acetate-CoA ligase. This family includes acyl- and aryl-CoA ligases, as well as the adenylation domain of nonribosomal peptide synthetases and firefly luciferases. The adenylate-forming enzymes catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain.
PRK10524	prpE	0.0	22	641	2	623	propionyl-CoA synthetase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	2.66e-241	20	642	578	1210
CAE6201338.1	3.63e-241	20	642	589	1221
BAY30132.1	1.08e-23	60	615	566	1079
BAY90071.1	1.43e-23	81	622	579	1089
BAZ75991.1	5.76e-23	60	622	566	1090

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P2Q_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2J_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2J_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2M_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2M_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2F_A	0.0	1	652	1	652	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	0.0	1	652	1	652	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MBA6	0.0	1	650	1	650	Acetyl-coenzyme A synthetase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=acs PE=3 SV=1
Q8D1G8	0.0	1	652	1	652	Acetyl-coenzyme A synthetase OS=Yersinia pestis OX=632 GN=acs PE=3 SV=2
Q87KU7	0.0	1	645	1	646	Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=acsA PE=3 SV=1
Q7MGU3	0.0	1	645	1	646	Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=acsA PE=3 SV=2
Q8DCZ9	0.0	1	645	1	646	Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=acsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003365.1_03073.