CAZyme Information: MGYG000003363_00101

Basic Information

• Species: Bacteroides sp900766195
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766195
• CAZyme ID: MGYG000003363_00101
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000003363_3|CGC2	45345.55	7.0759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003363	4177575	MAG	United States	North America

• Gene Location: Start: 112099; End: 113298 Strand: +

Full Sequence      

MKTLITTLGISLLLLTGCAGNKQTEANFIQENIDHAVAQQTLQVNLIERSGKILNPRTVN
KDGTVNYIPIDDWCSGFFPGCMWYTYQLTNDPKWLPLAKKYTEALDSVKNLTWHHDVGFM
IGSSFLNGYRFAGIETYKQVIIQTAKSLSTRFRPGAGILQSWDADKGWQAERGWKCPVII
DNMMNLELLFEATRLSGDSTFFHIAAKHADTTLKHHFRPDNSCYHVVDYDPETGKVRSRQ
TAQGYSDESIWARGQAWALYGYVMCYRYTKDPRYLEQSEKIYAMLLHQKHMPKDLIPYWD
FNAPNIPNEPRDASAAACIASALYELTTYLPGKGYKETADKIMTSLASPAYRAEVGKNGN
FILMHSVGSIPHGAEIDVPLNYADYYFLEALNRKRELEQ

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	70	393	6e-127	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.21e-11	47	300	2	234	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK86591.1	1.17e-244	1	399	1	399
QUU01323.1	1.37e-243	1	399	1	399
QUT61419.1	3.91e-243	1	399	1	399
QQA29909.1	3.91e-243	1	399	1	399
QUT37246.1	3.91e-243	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	6.10e-106	1	399	1	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.12e-49	29	393	28	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.17e-49	29	393	29	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	5.94e-49	29	393	29	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.16e-48	29	393	29	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.22e-105	65	397	69	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	1.19e-48	29	393	29	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	6.50e-48	24	393	20	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	2.51e-45	29	393	27	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9RC92	8.77e-45	62	393	29	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000070	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003363_00101.