CAZyme Information: MGYG000003362_02396

Basic Information

• Species: Dysgonomonas sp900079735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900079735
• CAZyme ID: MGYG000003362_02396
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	MGYG000003362_15|CGC3	99221.08	6.7866

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003362	3888864	MAG	United States	North America

• Gene Location: Start: 173043; End: 175622 Strand: -

Full Sequence      

MTGFSRYDDKTIDTENLSYIMNNIKYILLTLCLFPLILFAQADQFVSFSDKEDVFTLVKP
FIAAPILIDDNIDSGILKAITNLSVDVDKVTGVSPLLKVDKVSAEETLLLIGTIGRSKYI
DDLVKNKKINASELQGKYEKYLIQTVQNPFEGVKEALVIAGSDKRGTIYGIYELSKQIGV
SPWYYWADVPIKKQQNIYIKRGKYTEGEPAVKYRGVFLNDEAPALSGWANVTFGGFNSKF
YEKVFELILRLKGNFLWPAMWGSAFYDDDPQNGVLANEMGIVMSTSHHEPMAMAQSDWHR
YVKRNNLPNIWDYTKNTKALQESWRFGMKRAKDWEKVVTVGMRGDGDEAMSEDTNIALLE
KIVKDQRKIISEVTGKKPEETPQVWALYKEVQDYYDQGMRVPDDVTLLFCDDNWGNVRKL
PEINSKPHKGGYGMYYHFDYVGAPRNSKWININPIQRVWEQMNLTYTHGVDRIWVVNVGD
LKPMEYPISFFLDMAWNPSQFNPHNLLDHTEKWCEQQFGSTYAKEAARLINLYSKYNRRV
TPELLNDKTYSLENYNEFETVMNDYRNLVIDAMRLYYLMPSEYKDTFDQLVLFPINACSN
LYEMYYAQAKNKSYAAKKDVQANYWADKVKDCFKRDSLLTVHYNQTIAGGKWPHMMDQVR
IGYRSWNNPPKSIMPKVEYIMQTKDYQNKVFVEKNGYVSIEAGNYSRLNNSDKIHWDIIP
DMGKTKSAMTTFPQNIYPKENDNIYIEYDIDFESTGDFNVHLLLSPTLNFNANKGLRYAI
SFDGRNEQIVNFNGHYKGELGLWQAEAIIKSTTKHTITEKGKHTLRFRVLEPGIVLQKIL
IDTGGLKPSYLGAPESELK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	55	839	6.1e-282	0.994261119081779

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	207	544	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.95e-64	690	855	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	6.58e-04	97	174	52	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZB25839.1	0.0	21	858	1	838
QBJ85790.1	0.0	21	858	1	838
QWT87025.1	0.0	21	858	1	838
ADQ79783.1	0.0	41	858	24	842
QGK73842.1	0.0	39	858	19	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	1.84e-291	42	859	31	852	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	5.87e-284	55	859	17	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	4.23e-281	55	859	16	836	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.87e-225	41	856	9	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	6.64e-146	74	856	30	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.438546	0.557865	0.002235	0.000343	0.000328	0.000680

TMHMM  Annotations     

start	end
20	42