CAZyme Information: MGYG000003362_02213

Basic Information

• Species: Dysgonomonas sp900079735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas sp900079735
• CAZyme ID: MGYG000003362_02213
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000003362_14|CGC4	82576.3	5.5183

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003362	3888864	MAG	United States	North America

• Gene Location: Start: 90147; End: 92384 Strand: +

Full Sequence      

MRLNWITSFALLCLLILAGCGKDKDQRDAEVDKFVDDLLSRMTLEEKIGQTVLYTSGYDV
ITGPTVDPNYKEYLKKGMVGGIFNAVGADYTRSLQKIAVEETRLGIPLIFGYDVIHGQRT
IFPIPLAESCSWDLEAMERSARIAASEATAEGINWIYAPMVDISRDPRWGRVAEGAGEDV
YLGSLIAAARVKGFQGDNLSSVNTVVACVKHYAAYGATMAGRDYNTVDMSLNELWNTYLP
PFKAALDAGCGTIMTSFNDLNGIPATGNKYLLKDILRDKWNFNGFVVTDYTSINEMIPHG
YAKDEKHSAEIAMNAGVDMDMQGGVYMNHLKTLIDEGKVSERDVTEAARAILKIKYKLGL
FEDPYRYCDANREKADILTPANKDAARDMARKSMVLLKNDKQTLPLKENKRIALIGPLAK
DKYEILGCWSAMGNRDTIPVSVYDGLVEAIGKDKMSYAKGCDIQSDDTKGFAEAVRVAST
SDVVVMVMGEFHNMSGENNSRTNLSLPGIQVDLLKAIKKTGKPVVLVLMNGRPLTINWEK
DNLDAILEAWFPGTMGGAAIADVLTGKYNPSGKLTMTFPQNVGQIPLFYNHKNTGRPYDP
NVPQFAYGSRYWDVSNEPLYPFGYGLSYTTFTYSDLTLSSKEITKDSPLKVSVKLTNSGE
YDGEEVVQLYTRDLVGSVTRPVKELKGFKKVFLKAGESKVIDFTLSVNDLRFYNSQLEYV
YEPGDFHLFVGASSDTKLKTEFTLK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	321	1.5e-70	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	3	744	1	764	beta-glucosidase BglX.
COG1472	BglX	5.59e-112	42	463	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.98e-98	120	731	112	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.02e-91	43	354	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	3.46e-72	394	628	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEE49900.1	0.0	7	744	4	745
AZQ42842.1	3.36e-317	28	744	34	747
AYB33199.1	4.10e-317	14	745	12	740
ALC11686.1	2.98e-313	28	744	50	770
QTE22406.1	7.63e-313	31	745	20	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TF0_A	1.64e-266	30	745	8	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	2.74e-262	30	745	9	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.56e-261	30	745	9	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5P_A	2.12e-234	17	744	21	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5I_A	8.27e-234	32	744	4	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.33e-233	32	744	35	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.88e-232	32	744	35	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.12e-150	1	734	1	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.20e-125	21	745	26	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.45e-112	6	731	10	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000075	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003362_02213.