CAZyme Information: MGYG000003360_04285

Basic Information

• Species: Enterobacter_D kobei_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_D; Enterobacter_D kobei_A
• CAZyme ID: MGYG000003360_04285
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000003360_72|CGC1	81967.93	6.5458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003360	4794474	MAG	United States	North America

• Gene Location: Start: 22622; End: 24817 Strand: -

Full Sequence      

MAFPIRKLLFVSLLSALGSAGALAAEQSHFEHFITRDGAALKDGDRLFRFAGIHAPELHR
IEDDARGTCKADPRGWGQYFKWPTAEEQENWIKALVQTGAKAQRVYVLSVQQENDAACGR
ETHILSPETPDGMPRLNEVAMKVYDNMIAEADKQGLRLILPFIDHWWWWGGREQLAAFYH
EKPEDFYRTDSKTYQAYLDVIRQVITRTNTITRRHYYDEKAIMAWETGNELEDTNADFLH
QTSAWIRKWAPHQLVVDGTYKKVNDFALSDPNVDIISNHYYTNANNNHPEQVRKDLAAIG
GKKVYLVGEFGLLDQKDLNTIMQSIVHSEVNGAQAAGGFIWGFRGHRHDGGFYWHKEFTG
HYSYHLPGFPGEGKANQEMEVVNLVRTAAAQMAGQSKAPALPVPEAPRLRESNSPFAINW
MGSPVGRYYDVERATEPQGPWTRVGKDISDGKNEWDPSTMSLFRDDYRSLTLGQTYYYRV
IAKNESGQSAPSNVIRLKHTQKNLPPVVTLQDMLSTTVDKGVQLNAALQDDNLPDPKVSV
VWSHDGKNNVHFCDSSKKETRVWFSSPGDYALTFTADDGLLKSSKTINVSVKPAVRPVPA
DYCSFGSGTMEVSKGTLNSTKSEKDTLAIGEDGFLGPFAHDGDRVSWQVNAPWDGKFALH
VKFNGKWGSKKNSFIVNDGTPISIEFPQTDEKGQNIVVPVTLREGANTISFGKFAGDWGY
MFIKSIEVTAE

Enzyme Prediction     

No EC number prediction in MGYG000003360_04285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	351	3e-125	0.99609375
CBM35	614	728	8.6e-18	0.957983193277311

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16990	CBM_35	9.58e-41	611	730	3	119	Carbohydrate binding module (family 35). This is a mannan-specific carbohydrate binding domain, previously known as the X4 module. Unlike other carbohydrate binding modules, binding to substrate causes a conformational change.
cd04086	CBM35_mannanase-like	2.48e-16	609	729	2	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
cd04083	CBM35_Lmo2446-like	4.27e-10	633	728	27	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04081	CBM35_galactosidase-like	3.09e-08	649	719	45	117	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
cd04082	CBM35_pectate_lyase-like	7.72e-05	642	709	35	106	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOP91408.1	0.0	1	731	1	731
QII35092.1	0.0	1	731	1	731
QMR42253.1	0.0	1	731	1	731
QUS05601.1	0.0	1	731	1	731
AWD04759.1	0.0	1	731	1	731

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BGO_A	1.78e-06	633	728	26	119	MannanBinding Module from Man5C [Cellvibrio japonicus],2BGP_A Mannan Binding Module from Man5C in bound conformation [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6YM50	2.65e-08	131	250	99	231	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
Q9FZ03	2.65e-08	131	250	99	231	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
Q9FJZ3	8.55e-08	137	341	105	362	Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana OX=3702 GN=MAN7 PE=2 SV=1
A1C8U0	1.51e-07	145	281	185	336	Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=manF PE=3 SV=1
O48540	1.79e-07	131	250	87	219	Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum OX=4081 GN=MAN1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000399	0.998800	0.000183	0.000224	0.000186	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003360_04285.