CAZyme Information: MGYG000003359_04576

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_04576
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000003359_50|CGC1	95513.47	4.7484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 4231; End: 6726 Strand: +

Full Sequence      

MLLVDLGGAWRMKRLDQAEWLPGTVPGSVYYDLLNAGQMPDPYFRDQEYEVLELSNYDYE
YERTFRLDESAVAHDRVVLLCEGLDTLAEVYLNGTPVLNADNMHRTYEVDVKPLLVIGAN
RIHVILRSPVEYVMRKQAERPLIGCADAVPGISHLRKAHSMFGWDWGPQLPDLGIWRAIT
LRGYDRCRIEDVYITQAHEPGKVSLDVRVRTNGWAEGSREIAVRVTGPSGNVIETGVSER
TEQSTAGPDGVLQERHIPVEIPNPELWWPNGLGEQPLYEVEIVLNELGQELDRRELRIGL
RTLTVLQEEDEWGEAFQIVANGIPFFSMGADYIPEDNIFPRRSKVRTEHLIRSCAEANFN
TIRVWGGGHYPEDYFYDLCDEYGIVVWQDHMYACGVYELTEEFKENITQETIDNMKRLRH
HASLGLWCGNNEQEMAWDEWNWAEQTSLQLQADYIKMYEVLLPEIAKEIDPNTFYWRASP
SSKGSFDKPNDENYGDMHYWDVWHGKKPFTAYRTLYPRYMSEFGLQSFPSLKTVETFTLP
EDRNIFSYVMESHQKNGTGNEKILYYIGETYRYPKDFSSLLYASQLIQAEGMRCGVEHWR
RHRGRCMGALYWQLNDIWPVASWSSIDYYGRWKALQYEAKRFFAPVLASACEEGTRVALH
VSNESKRTAKGNLVWTLRNARSEVLRQGERAAEIAQFATAELEQLDFAGELDTKAKQRDT
YLEYAWVADGEIVSGGTVLFVKPKHFGFLDPGIQAAITEEEERFRITLGSEAYARFVELD
FAGLDAIFSDNYFDLSAGTRKTVTVAKSALSRPAGLTELQERLTVRSVYDI

Enzyme Prediction     

No EC number prediction in MGYG000003359_04576.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	707	6.9e-104	0.6848404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.32e-109	5	781	14	763	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	5.61e-25	750	830	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	3.44e-14	188	301	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	9.26e-13	61	432	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	2.68e-12	655	745	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ25428.1	0.0	1	831	1	821
AIQ37152.1	0.0	1	831	1	821
AIQ75814.1	0.0	1	831	1	821
QLG40119.1	0.0	1	831	1	821
ANS75587.1	0.0	1	830	1	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	3.47e-174	1	828	3	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	3.57e-174	1	828	3	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.56e-173	1	828	1	848	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.64e-173	1	828	3	850	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.74e-172	1	812	8	823	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QYN2	2.73e-113	6	805	9	828	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	1.61e-110	13	653	19	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q0CCA0	4.18e-110	5	653	8	661	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
B0YBU9	6.11e-110	13	653	19	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q29444	6.72e-110	4	830	23	877	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_04576.