CAZyme Information: MGYG000003359_03003

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_03003
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000003359_31|CGC1	40248.51	4.5262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 4647; End: 5711 Strand: +

Full Sequence      

MDRRELDWAPLAERMHRDLIACYLNEQTGILDQWYPRAAGRAGENFYYWWQAHVLDVLVD
AYERTGDPALPDRMRRFCRSLEYYNGGTFTHNYYDDMEWTALALLRAYRATGEPWYEEKV
QELWTDIQTAWNEHCGGGMAWKKDQLDYKNTPANAPAAILAARLYGLSGRPDDLAWAKRI
YEWNKTHLVDPETGFVWDGMNRTGDGTIDKDWKFTYCQGVFIGAGVELYRITGESAYLED
ARRTAAACFEELAEPVIGLLPGEGIDDTGLFKGILIRYLVRLLEVDPACPHVREVILANA
ETLRSDGLLENPLLCGPSWKEPPALPVQLSVQLSGLMLLEAAAKLEVRSEEAAQ

Enzyme Prediction     

No EC number prediction in MGYG000003359_03003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	334	8.1e-98	0.8603351955307262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	8.24e-69	46	346	43	371	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	2.70e-40	47	319	33	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam00759	Glyco_hydro_9	0.002	83	135	205	250	Glycosyl hydrolase family 9.
pfam07221	GlcNAc_2-epim	0.002	168	259	230	319	N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase). This family contains a number of eukaryotic and bacterial N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) enzymes (EC:5.3.1.8) approximately 500 residues long. This converts N-acyl-D-glucosamine to N-acyl-D-mannosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75148.1	2.59e-204	8	351	17	360
AIQ18389.1	3.24e-171	5	351	10	356
QUL53853.1	3.03e-170	7	345	12	350
QQZ59758.1	1.08e-168	7	346	12	351
QOT09052.1	2.77e-168	7	345	365	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.20e-87	7	346	53	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.92e-86	7	346	54	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	3.12e-85	7	346	54	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	3.17e-83	8	347	3	342	ChainA, Lin0763 protein [Listeria innocua]
4MU9_A	7.10e-29	8	293	4	314	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ACZ2	5.74e-10	48	319	64	364	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
Q05031	2.45e-09	112	241	145	281	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_03003.