CAZyme Information: MGYG000003359_03002

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_03002
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000003359_31|CGC1	40536.32	4.2954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 3562; End: 4647 Strand: +

Full Sequence      

MKTTTKETDVRRQRADLAQTALDEGFWNEEIRMYNIQTPCENGACNEIFHYWWMAHAVDV
LVDGLRRTGERRYAERLEELYDGLLRRNGGAWPNELYDDMEWMALAWLRAYQATGEPRYK
EATLLLWQDIQTGWNEQMGGGIAWQKSQLDYKNTPANAPAVILAARLYQAFGDPDDWAWA
QRIYDWQAANLVDPATDLVWDGMNRTGDGAIDKDWKFTYCQGVFIGASVEMYRVSGEAAF
LEAALRTFGVVLREFTSGETGLLPEEGDGDAGLFKGILIRYLAQLAQAAPDHREVAEYVG
LQAERAWSRLAVPEQPRFGTDWSRGPAPEATVSLSSQLSGVMLMEAASGLTPDAAPEGET
P

Enzyme Prediction     

No EC number prediction in MGYG000003359_03002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	37	345	1.1e-92	0.8743016759776536

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	8.37e-72	15	347	7	367	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	5.64e-42	50	341	33	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	9.69e-07	48	183	408	563	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam07470	Glyco_hydro_88	8.56e-04	87	262	12	172	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.005	157	274	211	331	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY75147.1	2.91e-192	8	352	6	351
AIQ68916.1	3.74e-169	7	351	7	349
QQZ64307.1	2.60e-166	13	345	10	340
ANE45498.1	4.26e-166	14	350	9	343
AIQ18388.1	1.67e-165	13	345	13	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.07e-78	28	346	60	385	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.47e-77	28	346	61	386	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.74e-76	28	346	61	386	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	3.57e-72	15	350	7	340	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	4.88e-26	16	308	8	305	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ACZ2	4.39e-07	50	306	63	347	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
Q05031	7.84e-07	50	306	68	350	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_03002.