CAZyme Information: MGYG000003359_01151

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_01151
• CAZy Family: GH94
• CAZyme Description: 1,2-beta-oligoglucan phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1117	MGYG000003359_9|CGC2	126505.29	5.041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 49780; End: 53133 Strand: +

Full Sequence      

MTTAAEAKKVLQAGDLIFTLWDSGDMFEMKFRDILINQLLSGPVEGSLNNLYLRLHRPEG
IRAVPLLGIRSNGRLSFGTDAAVWRGEAEGIQYEVVLKLDSRGAWFWDVRLEGQTSFEID
VVYGQDIGIAEPGAVRSNEAYLSQYIDHVVFEHPRRGKIICSRQNQPQRGKFPYLQQGAL
TGTTGYSTDGFQFFGLSYKESDRPEALECKDLANEIYQYEFAYAALQTSRQLLEGQARFV
FYGLVWEDHPEAVEALEFEELIEEAWRDKDAAAVTAAEAAAPVSPAVGLGEPLSTLPMED
AEIEACFPHRHHEEFEDGELLSFFTDTHEHVVLKEKELRVERPHGIILMSGENDRVGSEV
LTTTSYMYGVFNSQIVVGNTSYHKLVSNVRNALNVSKASGQRIYVEMDGVYRLLTMPSMF
EMGFNYARWTYKTAEDTILVTNHTASESPELSLNIVSAKGRAYRYLVTNQIVMNDLEFQR
PYVMEQKESVLTFRADREALSASVYPDLAYRMHVTGTDFQVFDERRLAPGAAPGSSSLVV
LETEPSSDWTLTVQGLLHGGVPQPAIREMHEETVRYRAFLGRVMNGFRLSLEEESTPASK
ELQKLNALAWWYTHNMLVHFSVPHGLEQYGGAAWGTRDVCQGPAEYFLATQKYGVVKDIL
KTVYTHQYEEDGNWPQWFMFDRYARIQQEESHGDIIVWPLKVLGDYLTATGDFGLLDEEV
PYTKKGSFEPSAKPATIREHAKKEIDYIRGHFLHDTFLSSYGDGDWDDTLQPANAQLKRY
MSSSWTVALTYQTFRQLAEALPEEERDWADELAGLAEGIQRDFNQFMLDTDVIPGFVYME
QPGQAERMLHPTDTKTGIRYRLLPMTRSMIAELLTAEQAEAHYGLIKEKLYYPDGVRLMD
RPAKYRGGVSTHFKRAEQASNFGREIGLQYVHAHIRFIEAMAKLGKAEEAWNGLHKINPV
GLKDAVPNAELRQSNVYFSSSDGKFSTRYEAEERFDELRGGDVPVKGGWRIYSSGPGIYL
NQLISNCLGVRQQGEDLVLDPVLPPHLDGLRLDFAWRGTPTTFVYRMDGQGHRVRINGSE
IPVRENPGFYRSGGVRISRQDFTAHGSNDHNVVEIFI

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	100	1082	8.2e-184	0.9507722007722008

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	0.0	12	1087	14	1039	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	4.10e-14	698	964	130	374	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS77874.1	0.0	1	1116	1	1118
ANY70636.1	0.0	1	1117	1	1120
QLG41761.1	0.0	1	1116	1	1122
BBH23617.1	0.0	1	1117	1	1114
AWB45776.1	0.0	1	1117	1	1123

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H41_A	5.78e-307	10	1111	12	1107	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H41_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose, isofagomine, sulfate ion [Lachnoclostridium phytofermentans ISDg],5H42_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg],5H42_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with alpha-d-glucose-1-phosphate [Lachnoclostridium phytofermentans ISDg]
5H3Z_A	5.41e-299	10	1111	12	1107	CrystalStructure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H3Z_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans [Lachnoclostridium phytofermentans ISDg],5H40_A Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg],5H40_B Crystal Structure of 1,2-beta-oligoglucan phosphorylase from Lachnoclostridium phytofermentans in complex with sophorose [Lachnoclostridium phytofermentans ISDg]
4ZLE_A	1.65e-07	667	959	376	653	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q92AT0	5.09e-315	1	1103	1	1070	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1
P20471	1.06e-11	633	1077	2390	2806	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q9F8X1	1.56e-06	689	1058	421	754	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_01151.