CAZyme Information: MGYG000003359_00497

Basic Information

• Species: Paenibacillus_A sp900766135
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900766135
• CAZyme ID: MGYG000003359_00497
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704	MGYG000003359_3|CGC9	78906.2	6.0998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003359	5721146	MAG	United States	North America

• Gene Location: Start: 350024; End: 352138 Strand: -

Full Sequence      

MTEFFSKRRSAAARLGCRDFEGILSLVAGRYMSDNPALPPVFRVFNRMGFRQSADGKYDI
NLADRLPETEYGRYAYVCGLVWSDVQRPVELSLHCYGPTLFWLNDDMVYKSGIAEEVNRS
ISKTVTIDLKPGWNELLLRLGCSPSGFGCLIGASRSKWSPLDVLSPFRERQGQAGWVYSE
ATQADAIPEKGHFASSSEAASRLQWYPKTISYNEEGDYILSWSTLRLPLAGRRIVRFSGH
SFGETQLFVDGRCLFAGRSGPWQREEELAQGTHSVVVIATGDFELQASCEGKPLDWHCPH
PVHGYDGDWLCIGGFRQPPAPIAQEQPSIMTIYEDGGEARYWRAGATNRWIRPYLENPAY
GQWNYSVGVTLYGLLQTGRILARPDITEYAGKHLQICVSAYPYALWSGKEYGYPSVNRQL
IEMNMLDDCGSCGSAVLEAGIASGDADGALVADRIAHYILNEQERKSDGAFFREQKGYFM
ENTLWADDLYMCVPFLVRYAGFRGNAAGLDEAARQCLLYRAYLFMPEVRLMSHVYDFKYN
TPTRVPWGRGNGWTLFSLAELLTKLPKKHPSYDAVAAFFLEMSLGVLQVQGESGMWHQVL
TDADSYEETSCTAMFVYALARGIRLGLFADPAKYAHAVESGWLALTEKSIDQYGNVYGVC
QGSRYSFSADYYKHDLPWRTNDTHGIGVVLLAGAEVARLHKEGN

Enzyme Prediction     

No EC number prediction in MGYG000003359_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	355	698	1.5e-83	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.09e-54	354	699	18	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.42e-45	363	699	34	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG37373.1	2.50e-222	1	701	1	735
APO43433.1	4.17e-220	1	701	1	732
QZN78692.1	5.41e-218	1	701	1	732
QOS82185.1	1.60e-217	1	701	1	765
CQR55648.1	1.10e-215	1	701	1	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.07e-39	355	699	72	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.30e-22	356	701	32	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.84e-22	356	701	22	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4CE7_A	2.21e-16	485	699	154	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
4WU0_A	4.86e-16	460	699	106	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.26e-21	356	701	32	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	2.97e-20	431	701	77	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	1.29e-15	485	699	161	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.73e-15	485	701	159	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P0A3U6	6.78e-12	491	695	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003359_00497.