CAZyme Information: MGYG000003355_03496

Basic Information

• Species: Lachnoclostridium phytofermentans_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium phytofermentans_A
• CAZyme ID: MGYG000003355_03496
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	MGYG000003355_150|CGC1	87548.98	9.1295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003355	5194070	MAG	China	Asia

• Gene Location: Start: 8880; End: 11210 Strand: +

Full Sequence      

MKMNGFTQNIHGNNSYINNKSLKRLMKSVFHLLIVTIFLIPPLPIQASERISEDSTADRN
TMKTVNPKSGELHAFYPSNAVFSDQMKMYIDELDSISFAWSRIDAKDSASLNTVKGKNGN
FGFYYPKDYLKPLEYAKSQGKSIQLNVYMDGADATKLLPYAKEQQAMIQSIVSTMETNIT
EGIGLTYDGVVIDFEGLRDTDNHNVPILYDGNQISTYYSQFLKELKEQLDLIDKKLYVAV
NPLLYFDGYNYADILHIADRVILMAHDYEPTKKLQKNQIEQYTGYNALEPISSLAPIQMV
RKALNDIKSAASDSSQLSKVWLQITFDAAQWQFDAKSAKNWEELSDTTLSRAGRLTPLYQ
SIKARVDNNDGYGENITCGYNNELQSPYIQYYNSSDRSWNVILYEDSTSINAKIELAKDY
QLGGISLWSLANIPDYNDKTGKKFHLNGWSTIISKMNSYDTLSPDSNKYISFTDTKVEQA
VREKLGKDTGNISVKELLSIYRLKLPQGVKSLKDISKLTNLEYLDAGQLKLKDITAIENL
TKLRVLYLQRNSISDISALKKLSKLEVLSLNGNQIVSITPLSTLTNLHELYIRENKISNI
EALNKLTKLELLEGGKNSIQNIENLKNLKNLKSLSLDDNQINNITGLKALTNLKNLDLSN
NKITTINALQNISGLETLYLQRNNISNISALSALKKLRVLSMNGNEIADLKPLAKLTLLE
KLYLKDNKIKNIASLKGLVKLNELYLKGNSISNYGPVNTVYSKNQFLCDFKINKGD

Enzyme Prediction     

No EC number prediction in MGYG000003355_03496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	104	432	4.8e-27	0.8209459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00033	LRR_RI	1.99e-43	543	756	1	232	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
NF033189	internalin_A	2.10e-43	461	760	36	359	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
sd00033	LRR_RI	1.84e-40	516	714	20	234	leucine-rich repeats, ribonuclease inhibitor (RI)-like subfamily. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
NF033190	inl_like_NEAT_1	7.37e-39	454	774	173	503	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
NF033189	internalin_A	4.81e-38	497	731	184	418	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42184.1	2.35e-273	19	551	18	550
AEY67763.1	5.33e-155	68	551	34	501
ACL77187.1	3.28e-150	62	551	28	501
AOT70741.1	2.64e-65	62	453	80	469
QGG48974.1	3.32e-61	65	453	210	577

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.110255	0.881371	0.007169	0.000621	0.000302	0.000285

TMHMM  Annotations     

start	end
28	45