CAZyme Information: MGYG000003355_03278

Basic Information

• Species: Lachnoclostridium phytofermentans_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium phytofermentans_A
• CAZyme ID: MGYG000003355_03278
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		73569.44	5.9543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003355	5194070	MAG	China	Asia

• Gene Location: Start: 2069; End: 3997 Strand: -

Full Sequence      

MSTYQPLKLSNFRSNQGFFHHYQELITHTVLPYQYKILNDEIEGVAKSHAIENFRLAGKV
LRGEPIFDGFYGMVFQDSDVAKWLEAVAYSLVVFPDSSLEQLADSVIDLIEQAQEKDGYL
NTYFTIKDKDKRFTNLQEAHELYCSGHMMEAAVAYYEATGKDKLLQVMKRNADHLYEHFM
IKNPHGYSGHPEIELALLRLYEVTKEERYLTLCKHFIDIRGEEPNYFKEEVKKRTWQVWG
MNAEDTDYMQCTKPVREQTVATGHSVRAVYLYTAMADLSFYVNDDDLRSACDTLWNNITK
RQMYITGAIGSTVLGEAFTKDYHLPNDTVYGETCASIGLIFFAQKMLKLHKHSRYTDVLE
RALYNTVLAGMQLDGKKFFYVNPLEVIPGISGEVNTHRHVLPKRPEWYACACCPPNVARL
LTSIGSYAYAEEGTTLYCHLYVAGEIKTNFGKVIECIGNYPYDGSITYQIKSRGTYTLAI
RIPDWSNHTTITYNHKSVSLTEITKDGYAYLTFDYQEGDEIELNLDMSVHKVYTTTKVSN
NSGLVALQRGPLVYCVEGIDNQNDILSLSISKDAEFLVQPYEENVLSGTVTLTFTGLRTE
EVNTLYTYTKPKEHPFTITAIPYYTWGNRGISQMRVWLPEKC

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	15	555	8.8e-204	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	0.0	16	641	16	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	2.84e-150	11	555	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04792	LanM-like	1.13e-05	153	212	602	675	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG4225	YesR	1.79e-04	154	252	47	142	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG4403	LcnDR2	0.005	153	233	752	835	Lantibiotic modifying enzyme [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ60849.1	1.60e-272	9	641	5	638
BCN30788.1	5.14e-269	9	640	5	638
ADZ82012.1	8.49e-265	9	641	5	638
QEH67728.1	1.13e-262	9	641	5	638
CBK96106.1	3.97e-247	1	639	1	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.96e-210	10	641	14	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.88e-201	10	641	14	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	8.52e-159	23	636	14	654	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.20e-158	23	636	14	654	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	3.38e-158	23	636	14	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.67e-158	23	636	14	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003355_03278.