CAZyme Information: MGYG000003355_02161

Basic Information

• Species: Lachnoclostridium phytofermentans_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoclostridium; Lachnoclostridium phytofermentans_A
• CAZyme ID: MGYG000003355_02161
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000003355_94|CGC1	42903.75	4.9635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003355	5194070	MAG	China	Asia

• Gene Location: Start: 10142; End: 11230 Strand: +

Full Sequence      

MVFDLYFKQYLEEFNEMELERWNYHFGCVLIGAMYLYQVTGEQIYYDAILNFGNRYVDND
GTIIGYVAEEQNVDLMASGRLLYFLYDNTQEEKYLKGIHSIMKHLKNQPRTSQGNFWHKK
IYPFQVWLDGLYMVQPFYMEYEKRFNHKENYEDTIKQFDNVREYLYDEEKHLYYHAYDER
KVMKWADKKTGRSPSFWLRSMGWYLMALVDCYEISEEKNAQETFGALLKEAIEGMKEYLD
QEHLLFYQLIDRKDLDGNYLETSGSAMVSYAILKGARMGAIEKEYISVGEKILAALEAQK
MIVRDGKFHLIDTCKSAGLGPKEERDGSAEYYLSEPISEDNAHGVATCMMAYAEWRKCKE
MR

Enzyme Prediction     

No EC number prediction in MGYG000003355_02161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	15	356	2.5e-94	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.78e-75	21	354	33	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.92e-68	21	354	26	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ62178.1	1.61e-128	3	354	8	361
BCJ93648.1	1.92e-126	6	360	9	366
BCJ96410.1	2.69e-116	6	355	9	361
QJU19057.1	4.39e-110	1	359	1	362
ASN96698.1	2.41e-109	1	355	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	6.68e-82	20	355	21	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.77e-65	21	354	38	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.59e-64	21	354	28	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	5.05e-12	22	320	65	348	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	9.41e-09	22	355	66	377	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.06e-64	21	354	38	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.88e-36	133	354	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.88e-36	133	354	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	6.73e-07	127	296	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003355_02161.