CAZyme Information: MGYG000003353_01456

Basic Information

• Species: Prevotella corporis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella corporis
• CAZyme ID: MGYG000003353_01456
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000003353_292|CGC1	33968.38	9.2111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003353	2741974	MAG	China	Asia

• Gene Location: Start: 1378; End: 2271 Strand: -

Full Sequence      

MKYTALIVTFNRLGKLKKTVEETLKLEFTNIVIVNNGSTDGTQAWLSSIVDTRVIVLTLT
ENTGGAGGFKTGSQYICEQLASDWVFFYDDDAYPYPDTLKSFSQLDKQGCRVFSGLVKDP
QGKPCPMNMPFSRVPTSLGDTVRYLRYPGEFIPAANRSMFVQTVSFVGMVIHRDLLTTSL
DHIHEQLFIYFDDLYFGYQLSLAGEQIMYSPELLFYHDVSIQGKLIAPEWKVYYLCRNLI
LSKKIFQKNAVYSNSAIAIRILKYILILPWQRQKYSYMKFILRGISHGIKGISGKYH

Enzyme Prediction     

No EC number prediction in MGYG000003353_01456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	118	2.5e-18	0.6764705882352942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	5.38e-52	5	241	1	201	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.15e-38	1	297	3	299	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	8.03e-16	4	100	1	97	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	6.38e-14	3	217	4	211	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	1.12e-11	5	100	1	96	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJK43708.1	3.24e-218	1	297	1	297
ASB06323.1	3.24e-218	1	297	1	297
QJM73762.1	3.24e-218	1	297	1	297
QJM77554.1	3.24e-218	1	297	1	297
AZL43288.1	3.24e-218	1	297	1	297

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003353_01456.