CAZyme Information: MGYG000003352_00835

Basic Information

• Species: Parasutterella sp900766055
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Parasutterella; Parasutterella sp900766055
• CAZyme ID: MGYG000003352_00835
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000003352_57|CGC1	37975.55	9.8048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003352	2608523	MAG	China	Asia

• Gene Location: Start: 17186; End: 18268 Strand: +

Full Sequence      

MSKHLVIAAAGTGGHVMPGVAVAKILISRGWTVSWIGTEQGMERRIVERQKIPFTALDFQ
GLRGKGLKTMLFGGFKLLKCIAQSRTILAQKHADAVFSTGGYIAVPVCLAAGLKGIPYVL
MNSDADPLLSIKMVQGNAAGVMCGFDGKAAKLAGDKGVVTGNPVRKEILAIPAPEERYQG
REGRLKLLIFGGSLGAQVFNQNVPSSIAALPPEKRPEIIHQCGMKAVEEVKASYAALGIE
AQVIPFIEDMAAAYVWADVVLARVGAISVSELTAAGVPSILVPLVTKTTSHQVGNAKYMQ
EAGAAIYLPQSELTTGKLTALLEGLNRKELLGMAKKAKALGKPDAAATVADFIEYVSNKE

Enzyme Prediction     

No EC number prediction in MGYG000003352_00835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	187	345	2.7e-46	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.94e-138	2	354	1	352	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	3.62e-119	4	352	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.57e-110	5	359	3	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	6.70e-107	3	353	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	5.65e-41	2	326	1	323	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ95911.1	3.46e-189	1	358	1	358
ANU67058.1	3.46e-189	1	358	1	358
BBF22505.1	8.31e-129	3	354	7	358
QQS89342.1	2.66e-121	3	356	14	367
QDA55069.1	4.21e-119	5	354	13	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	3.95e-75	1	351	1	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	2.15e-74	3	357	7	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	4.41e-74	3	354	10	363	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1GZ01	6.14e-116	1	357	1	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=murG PE=3 SV=1
A2SCY5	1.45e-111	3	360	4	365	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1) OX=420662 GN=murG PE=3 SV=1
A6T2F8	8.06e-109	3	354	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Janthinobacterium sp. (strain Marseille) OX=375286 GN=murG PE=3 SV=1
Q7NPZ9	7.32e-105	2	359	3	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=murG PE=3 SV=1
A4G8T8	1.11e-103	3	354	2	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Herminiimonas arsenicoxydans OX=204773 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003352_00835.