CAZyme Information: MGYG000003351_00612

Basic Information

• Species: Bacteroides sp900765785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900765785
• CAZyme ID: MGYG000003351_00612
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254	MGYG000003351_87|CGC1	28960.3	6.0266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003351	6569749	MAG	China	Asia

• Gene Location: Start: 18701; End: 19465 Strand: -

Full Sequence      

MIPKVIHYCWFGGNPLPEDAKKCIASWKKYLPDYEIKEWNESNFDVNCCPYVKEAYEAKK
YAFVSDYARFHVLYQEGGLYFDTDVEVIKNMDCIIAAGNFMGFEKSLATKQQECGATPRT
EVLGVAPGLGLGVNPGLALLGELLDFYEAKEHFVIEDGTVVDYTTDLLRKHGFVEEHRLQ
KVADITIYPADYFCPMDSTTGITTITPNTVSIHHYSCSWIDHNTLSWQLHILKNKLIGLL
GEKWVMRLSKILKR

Enzyme Prediction     

No EC number prediction in MGYG000003351_00612.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	94	2.2e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	6.37e-19	1	98	81	181	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.65e-17	17	96	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.54e-10	1	82	45	131	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	6	84	95	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.004	4	43	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA43512.1	9.93e-89	2	252	6	242
ATP00764.1	9.93e-89	2	252	6	242
QUT53709.1	1.71e-88	1	221	1	215
ALA75301.1	1.30e-84	1	253	1	247
QJR59783.1	1.30e-84	1	253	1	247

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003351_00612.