CAZyme Information: MGYG000003351_00254

Basic Information

• Species: Bacteroides sp900765785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900765785
• CAZyme ID: MGYG000003351_00254
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	MGYG000003351_48|CGC1	95839.42	7.053

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003351	6569749	MAG	China	Asia

• Gene Location: Start: 4469; End: 7081 Strand: -

Full Sequence      

MKHYIKYPLLALLLFLFPFSVARGQAYPYKNASLPVGERVEDLLRRMTLEEKIAQIRHIH
SWNIFDGQTLDEKKLSAFAGNIGWGFVEGFPLTGENCSKNMRLIQKYMIEHTRLGIPVFT
VAESLHGSAHEGSTIYPQNIALGSTFNPVLAYQKATSTSRDLHAQGMRQVLAPCIDVVRD
LRWGRVEESYGEDPFLCGVFACAETSGYLDNGISPMLKHFGPHGNPLGGLNLASVECGVR
DLHDVYLKPFEMVVTRLPVMAVMSTYNSWNRVPNSASRYLLTDILRKQWGFKGYVYSDWG
AIEMLQNFHHTAGSPTECAVQSISAGLDVEASSECYPYLKELVEKGQMDINVIDEAVRRV
LTAKFAAGLFEDPYGEKFGKQEMHDAESVALSRKIADESTVLLKNENGLLPLNLDRIRSI
AVIGPNAAQVQFGDYTWSRDNKDGVTPLEGIKRLVGDKATVRYARGCSMMSKDTSAISEA
VEIASQSDVALLFCGSSSASLARDYNQVNCGEGFDLHDLQLTGAQSELIRAVYETGKPVV
LVLVAGKPFCIPWEKEHIPAILAQWYAGEQAGNSIADILFGKVNPSGKLTFSFPQSVGHL
PAYYNHLPSDKGFYKKPGSYEVPGRDYVFSSPASLWTFGHGLSYTTFALEKMAVTLEHDS
IRVKAQIRNTGKRTGKEVIQLYVRDQVSSVVTPIKQLRAFMKVELQPGETREVVLSFPVA
ELSLTLEDGRRLIEPGAFELQLGTASDRILLKQTIHIGANGQLVGADGQPVSVADNLPAS
SVTKSVSAGKEIIVSGTVRDVQATLIDGVSIYSKTSGRELGRTDSKGRYKVRVSASDILV
FEKKGYLKLEVPVNNHTSLNVKMTYGDNNM

Enzyme Prediction     

No EC number prediction in MGYG000003351_00254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	110	330	1.8e-63	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.29e-159	40	749	38	757	beta-glucosidase BglX.
COG1472	BglX	5.21e-89	47	469	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.46e-85	26	743	39	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	6.15e-70	400	644	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.09e-61	48	363	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64332.1	0.0	24	867	36	872
QQA30647.1	0.0	25	866	25	857
QUT62191.1	0.0	25	866	25	857
QUT33795.1	0.0	25	866	25	857
QDO71585.1	0.0	20	866	9	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	3.04e-162	29	757	7	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.38e-161	29	757	7	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.61e-139	29	749	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.56e-121	40	746	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	8.44e-121	40	746	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.06e-128	9	746	6	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.09e-117	25	746	25	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	5.06e-115	40	749	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.84e-113	40	749	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P14002	1.84e-83	113	759	34	670	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999209	0.000147	0.000146	0.000138	0.000131

TMHMM  Annotations     

start	end
7	29