CAZyme Information: MGYG000003332_02045

Basic Information

• Species: Prevotella sp900550035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900550035
• CAZyme ID: MGYG000003332_02045
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000003332_174|CGC2	69536.01	6.3279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003332	2583592	MAG	China	Asia

• Gene Location: Start: 35943; End: 37811 Strand: -

Full Sequence      

MISLLFATLLATGAQAQKVYEVVPNGTGRKSLQGVQKKIRKSTANMTRDIVVLLNDGVYE
LEEPLRFDTEDGGKGGFTITYKAKEGAHLVVSGGYRISKWTVCPGNNNILQAKIENLPHL
RNLYVNGRRAKRASGDAKKATALYRVNGETKGLLFPKTEIPEFHHPSAMEINFLQNWRNY
YFHVDSIVDGKKLSDVADDHYLVMIRNFNWSYTMAYRALSPGAGEGAMNHFYFENAEELL
DEPGEWCFVPSTHTLYYYAQPGEKPETIEACVPRLEQLVEIKSSHEGQNVCNLIFEGIEF
SHNAWNWPSENGFAPIQSSAIICDNNATAGDAENNDQRKIKIPGAISIEDARNIRFRSNK
FTHLGSNGIDLKNNTDSVAVESNAFYDISGCAISVASWVHRTYNYPGEKPVNHTLIRNNY
IEKIGAEYASCVAIEAFYAENLKIEHNELFDLPYSGISVGWGWDINPSSQRNIEILNNSI
VGVIQKCYDGGAIYSLSHFSDKGLRIEGNYIDEITLKPRSNNEGAIYTDEQSSNVYINNN
VVKSNRKWYFFNAAGTVSVDTTYVPVGMRDNRGGNKSTNTHVSYVNDGSHIFVLPHPKAD
QLMEQAGMMKGQEAPDVVLQIK

Enzyme Prediction     

No EC number prediction in MGYG000003332_02045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	30	544	2.1e-134	0.9544592030360531

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.12e-08	344	541	1	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	5.95e-05	319	482	1	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.18e-04	409	559	6	129	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	0.003	297	403	56	152	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDS22682.1	2.25e-77	26	589	49	588
QDN75355.1	1.07e-66	30	542	58	564
AYC43854.1	2.04e-66	6	542	21	564
QDN84965.1	7.23e-66	30	542	58	564
QDO17263.1	7.23e-66	30	542	58	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	5.65e-45	24	559	44	597	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000455	0.998819	0.000172	0.000198	0.000169	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003332_02045.