CAZyme Information: MGYG000003312_02215

Basic Information

• Species: Bacteroides sp900547205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900547205
• CAZyme ID: MGYG000003312_02215
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000003312_61|CGC2	92152.38	6.7285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003312	4657579	MAG	Estonia	Europe

• Gene Location: Start: 132749; End: 135190 Strand: +

Full Sequence      

MNKVILCTMIMGLGISLSAFAQKRTINRDWEFQRLTERVQNAEIKNQGTDWNSQYNVEHV
DAAVSELRVPEDTLKAEFNLLRNGEWANVSLPHTPFVEDLTVLHQWQGICYYKKQLMITP
DEAQRQLWIEFEGAMHLADIWINGKHIMQHAGGYTPFVVDATGKLKAGVKNEILVRLDNR
NNPLIPPGKPLENLDFCYYGGIYRDVNLISKADVHITHPILADTRAGGGVFVTYPEVGEN
QSCIHIKTEIANQSAMAKQLTLRHTLFEWTRKSGKGKKVSVESQPLNLDNGEKRSCNQNM
VVERPKLWTPEHPHLYILLSEVLDEGKVVDYEETRIGIRHIEMTREKGFVINGQPLRLVG
SNRHMEYPYVGNAISDNAQYRDMYQIRSNGFNIVRLGHYPQDPSVLDACDELGLLAIEPI
PGWQFFNKSPLFAEFTYRDIRDMIRRDRNHPSVVMWETTLNESWPPAEWKDNAVRVAHEE
YPGEQCFTSGDAYGYDGFDVSYNDWQEGFHRPNKTKNPGFIREYYDYEFGGHYSTTRIRR
GDGEKAQIQNLWNAQWSHNRYRAYYPWTMGDAVWSMYDYNRGCCDNICYSGVADLFRLPK
FSLGFFRTQVAAGTPIPGGKMPFEVFIPTYRADVLSDTVSVYGNVDEVALWLNGKLVEKR
KADNGADTDYISYPDGGNCKQLAYPPFTFTKVPKEKGELKAVGYSKGKKVAESVVSTPGE
PARLHISYFESGRPASKDDLLIVHISLLDKRGVLCPLNAIPVSLSAEGGEIVGPSGYQTE
TGIASFLVRTADTAKLTLKATSGTMQKVKTLNL

Enzyme Prediction     

No EC number prediction in MGYG000003312_02215.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	580	1.1e-90	0.5771276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.08e-60	121	608	76	570	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	6.15e-46	111	481	68	428	beta-D-glucuronidase; Provisional
PRK09525	lacZ	2.28e-33	112	463	124	463	beta-galactosidase.
PRK10340	ebgA	1.98e-32	112	463	113	450	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	4.60e-20	345	590	4	282	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU07685.1	0.0	2	811	4	814
QRP57072.1	0.0	2	811	4	814
ASM65767.1	0.0	2	811	4	814
QQT77684.1	0.0	2	811	4	814
QRO23432.1	0.0	2	813	3	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	1.72e-62	72	793	20	741	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	3.35e-62	72	793	20	741	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5EUV_A	9.44e-58	89	800	29	716	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d],5EUV_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d],5LDR_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d]
5LDR_A	9.57e-58	89	800	30	717	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d]
5UJ6_A	8.83e-57	83	673	51	670	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	9.15e-92	64	802	10	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	5.01e-65	86	775	30	708	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KPJ7	8.57e-57	81	663	74	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	9.90e-56	83	771	52	739	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.38e-48	72	772	57	791	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001139	0.961587	0.036517	0.000260	0.000250	0.000227

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003312_02215.