CAZyme Information: MGYG000003310_00825

Basic Information

• Species: UBA10281 sp900764105
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA10281; UBA10281 sp900764105
• CAZyme ID: MGYG000003310_00825
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		72029.75	5.0008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003310	1965862	MAG	China	Asia

• Gene Location: Start: 250727; End: 252613 Strand: +

Full Sequence      

MFEKSKWIWERENPSPDEYADFRATVTEKNATLFIAAETDYAAYVNGKLAFFGSYKGYRD
EKYYDELPLNDFLTEKENEIEIVVWYQGINCSSSIDDGAGVIFEISSNGKILAASDENTL
SRSDIRYQNGYKKSLTPQIGYSFLFDATKCGEMKPELWHKSFALARNVKFSPRPVKKSVV
SAPVFSEEIKQENGVYLFDLKKEYSGQIYLDFYSETEQKILISYGEHIRNGEVARIVGNR
DFSFEYIAKRGENKYVNPFRRLGLRYIEVKTEQPIKVGKITLLSVDYPVKKRVFAADSPL
HEKITSVAIRTLALCMHEHYEDCVWREQALYTFDSRNEMLCGYKAFYDDGFARSNILLMS
KGVREDGLLELTYPAEDTPAIPLYSLCFIVLVYEYVKFTGDKSVLGKVGKTMRGIMDKFR
KLRDNRLIADFPYPYWNFYEWGNGSDNCGDLSRNAGDTSPERFSLILNAYYVYTEEKYAE
LFPLEKIELSDMKKLIAEKFYDEKAGMFRSYIGEKTYTEFGNALCLSIGLCGEDLAEKIT
QGKALKATLAAAAYVYDGLLSFGKKYEDYVINEIDENYKKMLDAGATSFWETVEGVEDGD
LSCSLCHGWSALPIYYYALTGKIKFSKE

Enzyme Prediction     

No EC number prediction in MGYG000003310_00825.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	190	616	8.5e-59	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.71e-09	294	615	6	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	0.001	189	269	1	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95627.1	1.21e-110	7	621	13	708
ARN56684.1	3.11e-95	1	617	19	708
QNK57365.1	1.29e-84	2	617	4	709
QGQ97405.1	7.21e-83	7	617	11	710
AQQ71631.1	7.58e-71	1	616	1	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	3.66e-12	260	616	169	537	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003310_00825.