CAZyme Information: MGYG000003291_01662

Basic Information

• Species: Faecalibacterium prausnitzii_M
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_M
• CAZyme ID: MGYG000003291_01662
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000003291_269|CGC1	27778.69	8.7854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003291	2081808	MAG	Mongolia	Asia

• Gene Location: Start: 2099; End: 2869 Strand: +

Full Sequence      

MGNSGLICYTKLSPNHSGQRTHAIDRITPHCVVGQLSCETICDCFPAGRNASCNYGIGKD
GRISLCVEEKNRSWCSSSNANDQRAVTIECASDKSEPYAMTTAVYASLVKLCVDICKRNG
KKKLLWFGDKVKTLAYNPAADEMVITVHRWFANKSCPGDWLYGRLGDLAAQVTAQLSGST
NSQTGFPAVPFQVKVTVSDLNIRKNPSMGNNTTGKFTGTGVFTIVEVKDGWGKLKSGAGW
IWLKNSNYCTVLNTVG

Enzyme Prediction     

No EC number prediction in MGYG000003291_01662.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01510	Amidase_2	2.08e-18	24	159	2	121	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
cd06583	PGRP	2.36e-08	49	160	34	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
smart00644	Ami_2	0.003	49	157	31	126	Ami_2 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22979.1	4.96e-120	3	251	188	449
AFB75734.1	4.96e-120	3	251	188	449
ADB89215.1	1.36e-96	3	251	15	447
CBL18646.1	7.43e-86	3	192	7	199
AFB76124.1	6.41e-58	1	179	6	182

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003291_01662.