CAZyme Information: MGYG000003287_01603

Basic Information

• Species: Prevotella melaninogenica
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella melaninogenica
• CAZyme ID: MGYG000003287_01603
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000003287_72|CGC1	53918.98	6.4977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003287	3259243	MAG	United States	North America

• Gene Location: Start: 14057; End: 15463 Strand: +

Full Sequence      

MSCSNRLLSTATAHFLSAVITDDFQNCGNHPDSLQTWLMPDIIGDDSIKADDSMYGKSAW
CTIEIPQNIKAGSYKLNLLLQQDGKTVSTIPFIIKVLNRKLTLSDNFHLNFWQQPYAASR
YYGVAPWSQAHLDILRPYMQLLARAGQRNASAILFYEPWGVQSNDKFDAMIETTRKADGT
WSYDYTAFDRWISFLDSCGINGDINCFSMVPWDMTFTYYDEASKSYKELKTTTNSKEYSD
LWIPFLRSFAAHQKEKGWFDRTVIAMDERALDAMQDAYRIAQEAAPGIKMSLAGNYHKEL
VDKIYDYCIAWKQQFTPEDLALRNSKGWISTSYTACPDAMPNVGSNNDPIEATYLPLYCI
ANGFNGFLRWAWMNWTDNPMYDSRFKLFTPGDTYIVYPGNHSSRRFEHIIRGVQNVAKIE
TLRKEYKQKRNQKAFQLLEDALSQFKNPTPNEAELRESIYKIESLLNK

Enzyme Prediction     

No EC number prediction in MGYG000003287_01603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	9	468	9.3e-182	0.862453531598513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	1.14e-16	363	423	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK97334.1	0.0	1	468	1	468
ASE18818.1	0.0	1	468	1	468
BBA29555.1	0.0	1	468	1	468
QUB60032.1	0.0	1	468	1	468
QUB59386.1	0.0	1	468	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L7V_A	3.10e-117	15	468	100	562	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	4.79e-117	15	468	115	577	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5FQE_A	1.18e-58	20	422	108	542	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	1.64e-57	20	422	108	542	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003287_01603.