CAZyme Information: MGYG000003282_01568

Basic Information

• Species: Coprobacter sp900545915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter sp900545915
• CAZyme ID: MGYG000003282_01568
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000003282_22|CGC1	97677.71	6.7766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003282	3080391	MAG	United States	North America

• Gene Location: Start: 43790; End: 46351 Strand: +

Full Sequence      

MTNYKKTLFAGIACVFMCSNLHAQETNFDLSSQRSEKQDVLPVPGKKIDHRGLIINPTPQ
KLGFIGNGKLDISQGFILKDKQKKFTSDLNFVTFNKNGAKLIVDFGKKAAEKQKVKNVSG
AYALNIHKNGISITGYDERGAFYGIQTLRQLLESPIAENKQLPCLEINDYPDLPNRGVVE
GFYGTPWSHEVRMSLIDFYGKFKMNTYLYGPKDDPYHSCPNWRLPYPEKEAKNIKQLIEA
SKRNRVDFVWAIHPGQDIKWNEEDYKNLVNKFNWMYDLGVRHFAIFFDDISGEGTNPSKQ
TELLNRLTDDFVKAKGDVSPLTVCPTDYSKLWADPTEKGSLAIYGKTLYPDIKVFWTGDV
VCSDLTKETLDFVNSRIKRPAYYWWNYPVTDYVRNILLQGPVYGLNTSLTEKDVCGIVSN
PMEHGEASKLALYGVADYTWNIAAYNALDNWERGLNELVPNAKDAYRTFAIHSCDTETGY
RRDESWETTTFRLANWTDEAARNLENEFEKIENVPAEMEKGCTNQKLMKELRPWLIEFGK
LGARGKHAIELTRIYRSGQNDTLFWNKYIQNLMSKEDRKSYEAHKSGTMKLQPFYENTMD
DMAHGFLKKLTGEIPMDYKGIGSFGNSSTTQTKLMLDNDTLTYYTSGIAQKAGDWIGIDL
RTVREVSEISILQGRNSIDDVDYFDHAVLEYSENGNNWKALTGELEKQYVIHWNGNPVKA
RYVRLKRLDSKRTNYASIRSFEVNPLHAENLGFKLETEDQEQALYAFDRNLGTSFKCNKF
IAFEVEKGIKSYILLMNRLSTPLKCKQLDAKGNLVSETILDSPFSKIQLENKNVEKISIE
GTAEIFEIIAEKE

Enzyme Prediction     

No EC number prediction in MGYG000003282_01568.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	176	470	3.1e-107	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.54e-169	176	469	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	4.24e-13	120	169	76	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	9.62e-09	636	739	18	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.80e-06	655	743	47	141	Substituted updates: Jan 31, 2002
COG3525	Chb	1.71e-05	119	230	205	316	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75783.1	0.0	1	850	3	851
BCI62100.1	0.0	1	849	3	852
ADV43394.1	0.0	3	850	2	848
AHF11939.1	0.0	1	852	1	855
BBL05673.1	0.0	6	850	3	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	2.65e-150	55	701	16	682	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	5.18e-150	55	701	4	670	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	5.34e-150	55	701	5	671	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2JIW_A	5.34e-150	55	701	5	671	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	5.83e-150	55	701	8	674	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	5.42e-149	55	701	26	692	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.99e-90	5	730	7	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	5.24e-90	5	730	7	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	2.35e-46	121	790	133	860	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q8VIJ5	1.61e-35	177	440	63	331	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000816	0.710982	0.287304	0.000340	0.000286	0.000255

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003282_01568.