CAZyme Information: MGYG000003277_02811

Basic Information

• Species: Duncaniella sp900762315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900762315
• CAZyme ID: MGYG000003277_02811
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000003277_143|CGC3	40430.03	10.2111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003277	3767547	MAG	United States	North America

• Gene Location: Start: 68855; End: 69937 Strand: +

Full Sequence      

MATKNPDIETRFRPAKVLITRFSAIGDVAMTIPVVYSVARSNPEVQFVMVTRPSMATMFL
NPPDNLTVRGIDLASPRYKGLTGLRKLYRELRQEYDFDAVADLHDVLRTMALDAMAWLNR
IPVSRINKERSRKRALTRRRNKIMLPLISQRARYREVFHRLGLAVEERFRSLFGDGKGNP
ADFAAITPPKAEGEKWVGIAPFAKHKGKIYPPELMEKVVAALAAKDNVKIFLFGGGDHER
EIFAGWASRYPGVISLAEKRHGFPVELSLLSHLDVMVSMDSANMHLASIVGVPVISVWGA
THPYCGFKGWKQQDTDTVQLTMTCRPCSVFGDKPCYRGDYHCLNGISPQTIIDKITARIS

Enzyme Prediction     

No EC number prediction in MGYG000003277_02811.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	85	336	4.7e-35	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	5.35e-42	16	355	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.24e-35	16	360	3	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.79e-12	85	341	2	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.77e-06	14	301	5	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37124.1	1.80e-164	14	359	2	346
QQR08225.1	1.17e-155	14	359	9	352
ANU64408.1	1.17e-155	14	359	9	352
ASB37493.1	1.17e-155	14	359	9	352
AHF12543.1	9.36e-121	16	355	5	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
17	39