CAZyme Information: MGYG000003274_00796

Basic Information

• Species: Collinsella sp900762355
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900762355
• CAZyme ID: MGYG000003274_00796
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000003274_24|CGC1	79142.8	4.7288

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003274	2117693	MAG	Peru	South America

• Gene Location: Start: 36765; End: 38927 Strand: +

Full Sequence      

MMIEEQVFEVSTERAGAYRSISDALAAADQLYPDAEQPVMIHVDPGEYRERVEIHRPHVT
LVGETADSVRIVGGLGAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCIAGHQDTLFLGPLPPREVKPGGFIGPKQFAPRRVGRQY
FRRCRIEGDVDFVFGGARAYFEGCEIRSLNRNMDVNGYVTAASTPEGEPYGFVFHGCSFT
APQDVAPDSVYLGRPWREWAQTVLIDCWLGQHIKREGWWDWNKPAAHERARYAGAILHGP
SGDAENWVPWSRELDATAAARYAREQVLAGTDGWDPEGGSSNTVETASLSDNGRTVHIDT
YYEDEPAFRDRLKREGRSAAFKGATPDDFEAWQIATRARLFDLLGLSIMDRAPIEVRELD
RVQIAGGIVRTHAMLQVEHNVWMPFYLLEPQTPKLDACGCKRCYICPHGHQGAGAASVAG
VTGVPAIDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSFLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYVPGLWRLLDMGDIASLIAPRPLLVQSCEGDHLN
GARGLANVDEQLDIVRDAYELVGHAGDLSHEVCPGGHHLGVAYLAEDIEWLDERAAGARA

Enzyme Prediction     

No EC number prediction in MGYG000003274_00796.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	3.3e-82	0.9826388888888888
CE19	465	697	1.6e-24	0.572289156626506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	5.27e-65	26	330	99	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.36e-51	16	330	10	297	Pectinesterase.
PLN02708	PLN02708	2.11e-42	16	336	251	550	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	4.05e-41	16	334	21	291	putative pectinesterase
PLN02773	PLN02773	9.32e-41	2	322	1	290	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	10	716	10	716
ATP54718.1	0.0	4	716	4	716
QUC03567.1	0.0	2	719	1	713
SET76962.1	1.57e-101	7	336	1	321
QRP39805.1	3.20e-101	10	336	20	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.12e-29	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	1.23e-25	11	289	37	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.72e-24	7	336	7	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	1.98e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.62e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	8.40e-37	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43062	1.25e-32	10	345	211	519	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q9LVQ0	3.96e-32	2	337	1	299	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8L7Q7	6.67e-31	18	331	301	600	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O81320	1.47e-30	10	311	167	437	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003274_00796.