CAZyme Information: MGYG000003268_00529

Basic Information

• Species: Prevotella sp900762125
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900762125
• CAZyme ID: MGYG000003268_00529
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000003268_71|CGC1	54721.12	5.0129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003268	2466924	MAG	El Salvador	South America

• Gene Location: Start: 18328; End: 19770 Strand: -

Full Sequence      

MKTEKIIDVFILQGTDEETAKNMMVMKDPLVSRVGVVGGNIRASKTWHQIANQTTAEYTM
VYLSHQYIQMGPLSLERMVDVIEVTGAPLVYSDRWKRPAEGARKDAPVIDYQAGSLRDDF
DFGSVLFLRTSSLKKAVTLMKADYQAAGLYDFRLKITEEALPVRIPEFLYTEVELDARKT
GERLFDYVDPRNRQSQIEMEQACTEYLKETGAFLDAPYPTLDFDKESFPVEATVMIPVRN
RIRTIGDAIRSALAQVTTFSYNVFVVENGPECHSTDGTTELIDEIAATDAKLVHIVPTRD
DLRVGGSWNTCIRDPRCGRFVVQLDSDDVYSGPDTLQKMVDTFREQQCAMVIGAYMLTDI
NLQPLPPGKIDHREWTDDNGRNNALRINGLGAPRAFFTPVVRQLMMPNVNYGEDYALGLA
ICRTWRIGRLYDAVYNCRRWDDNSDGDLDIDKENRNNLYKDRIRTWELLRRRALNAQTNK

Enzyme Prediction     

No EC number prediction in MGYG000003268_00529.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	1.01e-14	234	389	1	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.34e-14	233	397	1	157	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	2.38e-11	233	344	6	108	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	3.38e-09	233	355	3	118	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd04179	DPM_DPG-synthase_like	5.50e-09	234	353	1	114	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28090.1	1.41e-224	5	478	3	475
BAR50395.1	7.24e-182	36	477	50	485
BAR47653.1	2.06e-181	36	477	50	485
AEW21262.1	1.18e-180	36	477	50	485
QUT49366.1	1.56e-180	43	480	55	486

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003268_00529.