CAZyme Information: MGYG000003254_01629

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A
• CAZyme ID: MGYG000003254_01629
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626		70236.13	5.5189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003254	1848256	MAG	United States	North America

• Gene Location: Start: 112; End: 1992 Strand: -

Full Sequence      

MNIFKRKLLSVGAWACLVAAPAAAAPKNVAKTKPVPPRTHLSGYLGERIDACIRGRVMSE
DESLLAAPFRQQNETQAWQSEFWGKWTLGAIASYRYNGDPELLQKIRNGVELLLSAQLPD
GYIGNYAPEAQLTNWDVWGRKYTLLGLLAYYDLSGNKKVLEAARRLADHLLTQIPSRKSI
VEAGLYRGMPPSSILEPMVALYDRTGDKRYLDFAEYIVAQWETERGPRLIGKALEGVPVS
QRFVPDTRQEAWWSWDNGQKAYEMMSCYDGLLDLYKITGKPEYLEAVRKSVQNILDEEIN
IAGSGSAFECFYGGRARQTLPTYPPMETCVTMTWMKLCRNLLELTHDPLYADQIERTAYN
ALCAALKNDASQIAKYSPLEGARSAGEEQCGMHVNCCNSNGPRAFAMLPEVAVTQADDNI
YINLYGESNSTVRLPGGEVILTQTTTYPEEGDIEIAVSPRKAFEFGVSLRIPAWSRVTMV
SVNGESIGNIRPGSYLDIRRRWTPDDKITLRLDMRGRLVELDGCQAIERGPVVLARDSRF
ADGYVDETAVVQATDGYVTLLPVEEKPEKMWMAFTAPMVMGTDLEGEFAQPRQIALCDFA
SAGNTWNKNIRYRVWLRKTLNTIFDR

Enzyme Prediction     

No EC number prediction in MGYG000003254_01629.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	71	534	1.1e-62	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.77e-71	73	535	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.98e-60	33	535	10	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	2.80e-06	40	228	369	576	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	1.56e-05	86	215	553	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG1331	YyaL	1.08e-04	132	308	409	580	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	2.16e-202	38	625	26	615
AXC10260.1	9.18e-48	85	536	133	592
QOY86860.1	2.38e-46	85	568	97	578
QHS51661.1	3.83e-45	85	537	123	582
AIQ29277.1	9.70e-45	70	557	59	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	5.02e-37	89	540	78	553	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.13e-33	85	533	81	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.15e-32	85	533	81	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.77e-29	79	538	90	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.026390	0.710846	0.219313	0.038532	0.003642	0.001250

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003254_01629.