CAZyme Information: MGYG000003254_00133

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes_A
• CAZyme ID: MGYG000003254_00133
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38641.75	7.3035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003254	1848256	MAG	United States	North America

• Gene Location: Start: 258; End: 1289 Strand: -

Full Sequence      

MFDLSRSFEGITASRYPSHKPQYIPPFSLYWIAMVHDYWMHRDDEAFVAEFLPGIRSVVE
WFERHIDPQTGMLRSGMPHWNFTDWAEGWERGVAPESPSSGPAVTTLHFASALRDAAELM
ERFGKKNEAKDYASLSRRLTASVYENCWDPQRGLLRDCIGGGTYSQHANIMGILTDAIPP
KDQRRVFETITGDPSVTRTTFYYTFYLIRALKKTGLADRYVDMLGPWQRMIDIGLSTFAE
TPEPTRSDCHAWSSSPNYDLLATVCGIEPSAPGFASVRIAPHPGHLNRIRGTAPHPQGLI
AVELERDGKRIRGRVELPGHLGGTFVWNGRSARLRPGTNAIDM

Enzyme Prediction     

No EC number prediction in MGYG000003254_00133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	7	320	4.1e-75	0.625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.79e-19	31	256	103	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.06e-11	28	163	86	226	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17390	Bac_rhamnosid_C	1.09e-05	266	318	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA23168.1	3.44e-188	1	341	447	787
BCG53368.1	2.07e-160	2	343	480	841
BBK92465.1	1.21e-128	1	343	442	790
QJE29213.1	1.71e-128	1	343	442	790
QKH98771.1	2.41e-128	1	343	442	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	8.78e-21	24	312	382	682	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003254_00133.