CAZyme Information: MGYG000003253_00475

Basic Information

• Species: HGM11417 sp900761895
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; HGM11417; HGM11417; HGM11417 sp900761895
• CAZyme ID: MGYG000003253_00475
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000003253_49|CGC1	92815.77	4.8358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003253	2635273	MAG	United States	North America

• Gene Location: Start: 11950; End: 14385 Strand: -

Full Sequence      

MGKKKLILKDWSLKYGEQSLAVQVPGDIVGDLMDHGILPDVLFGDNYRQADWVHRRDWIY
STEFELSEEDASRQELLLVFHAIDTYAEITLNGKALGRTDNMFRKFSFDVRDSVRIGKNL
LEVKILSIREKESSFRNEKYSACFNDERLFIRKPQCHFGWDWAPNFPGTGIAGEVILSLG
ERGGIADVRVNSWLDGAVSFTVETTFNNRCPGEEPSAGERITVRAERAPGQGLEQALEVS
GEVCGSKNIFNLYVEAPRLWYPNGYGEQPLYAYEAVLEREGRIIDRKRGTFAFRTFEVRE
NPIGEQGRRFDMFVNGIRFRAVGSNWVPASIMTGRIPEERYRRLLTYAREAGINMLRVWG
GGLYEKDVFYDLCDRLGIMVWQDFMFACGAVPDDIESFRSEIESEATEQIVRLRNHPSLG
IWCGGNELTDSFRCDFAGYGKYIIRVMLPGLCAELDGTRRYVWDSPYALTDVGNDVSTGD
CHLNALSRATANGEIENYRRYQWDNENNFDTECAVIGMCRLRSFRKFMPEEKLWPQNSLW
EDRLACNPYDASVVSFTERINLTVDALFGPAGTLPEYIKKSMAAHSEVLRDEIEYYRSLP
FNSGVMNWMYNDIWGNATWSLVDYYLEKKPAYYAMKRAGKRRLVGFTLRRDGWYLHAVND
TAEVWSGELSWSHVTLSGKTLAEHTQTVQIAPFEQLSLPIAFDSSVKDAVLYARLGENDS
IYFYDLWKDKSFTTDLSVEIKAEGCRAEVTVRSNAFARMVFLDLPEGVEAELSDNYFDLL
PGSVKKVTILADRPITEREITVKTYADDWTE

Enzyme Prediction     

No EC number prediction in MGYG000003253_00475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	9	713	1.2e-88	0.6941489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.62e-60	10	680	18	651	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.30e-15	734	807	2	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	1.97e-11	59	478	112	488	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.28e-09	56	427	61	417	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	2.73e-07	185	294	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI68839.1	1.65e-185	11	809	10	830
AQQ71581.1	1.70e-163	16	811	34	836
AKJ63700.1	2.12e-133	18	789	26	823
ACK43074.1	6.32e-117	23	690	24	681
ACI19676.1	2.43e-116	23	803	24	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.94e-117	23	803	47	822	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	9.74e-97	17	802	23	829	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.01e-96	17	802	25	831	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	1.03e-96	17	802	25	831	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	2.67e-96	17	802	23	829	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	3.12e-75	6	789	8	826	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
I2C092	3.28e-73	23	789	30	838	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q0CCA0	9.82e-73	11	794	13	834	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
O00462	2.27e-72	10	670	28	719	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
A1CGA8	1.29e-71	9	794	11	833	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003253_00475.