CAZyme Information: MGYG000003252_04456

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_04456
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1093	MGYG000003252_424|CGC4	124607.41	6.3531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 114699; End: 117980 Strand: +

Full Sequence      

MKIYTLLLGTLIACPIQAQTVHDWENHHVLQINRELARAAFTPFTEQKGDCSLCLDGIWK
FRWTPVPDQRIIDFYRADFDDRDWTDFPVPANWEINGYGTPIYVSAGYPFKIDPPRVMGE
PKADYTTYKERNPVGQYRRTFVLPADWTAEGQTFLRFEGVMSAFYVWINGERVGYSQGSM
EPSEFNITKYLYSGENQIALEVYRYSDGSYLEDQDFWRFGGIHRSIHLMHTPDVRIRDYA
VRTLPLSTDNHQDFIFQVDPQFSVYRGFTGKGYTIQGVLKDASGKDVVTLQGDVEDILDL
EHKASRMNEWYPQRGPRKTGRLSAVVKSPHRWTAETPYLYRLHLTLQDSDGKVMEQVEQP
VGFRSVKIENGQLLVNGNPVRFRGVNRHEHDPRTARVMTDERMLQDILLMKQANINAVRT
SHYPNVSRWYELCDSIGLYVMDEADIEEHGLRGTLASTPDWHAAFMDRAVRMAERDKNYP
SIVMWSMGNESGYGPNFAAISAWLHDFDPTRPVHYEGAQGTDGNPDPKTVDVISRFYTRV
KQEYLNPGITEGEDKERAENARWERLLEIAERTNDNRPVMTSEYAHSMGNALGNFKEYWD
EIYSNPRMLGGFIWDWVDQGIYKTLPDGRTMVAYGGDFGDKPNLKAFCFNGLLMSDRETT
PKYWEVKKVYAPVLLGMENGDLKVTNRNHHIDLSSYRCLWTLSVDGKEKERGELILPEVA
PGKTGTITLPDFRSLSYNSSSNKRNKEKDVVKSAADCQLKVSIILKSDALWAKAGHEVAW
EQFCLQKGDLLSAGLANKGQLQIKEDDKTLQVSGRGFSVQWKKTVTGSMTSLIYNGKEML
AHSDDFPVQPVTQAFRAPTDNDKSFGNWLAKDWKLHGMDNPQISLESFDHQLREDGAVIV
QVRTNNIYKEGKITTTSAYTICSDGTIDLKTTFLPQGVLPELPRLGIAFCLSPSYDTFIW
YGRGPQDNYPDRKTSAATGLWKGTVDEQYVHYPRPQDSGNKEEVHYLTLTDKQNKGIRID
AVEDVFSASALHYTAQDLYKETHDCYLKPRAEVILSLDAAVLGLGNSSCGPGVLKKYAIE
KKEHTLHIRITKK

Enzyme Prediction     

No EC number prediction in MGYG000003252_04456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	46	977	9.1e-228	0.9667553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	22	1077	15	1011	beta-galactosidase.
PRK10340	ebgA	0.0	24	1077	4	984	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.37e-160	55	976	15	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.54e-104	366	673	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	5.54e-91	813	1090	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95873.1	0.0	1	1092	1	1092
QQA06595.1	0.0	1	1092	1	1091
ALJ42148.1	0.0	1	1092	1	1091
QUT38431.1	0.0	1	1092	1	1091
AAO76100.1	0.0	1	1092	1	1091

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	3.13e-202	22	1090	2	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	3.22e-202	22	1090	3	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6CVM_A	4.49e-185	23	1079	14	1008	Atomicresolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]
1JZ7_A	6.67e-185	23	1079	15	1009	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]
1PX3_A	6.67e-185	23	1079	15	1009	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O52847	9.89e-204	23	1065	19	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	1.76e-201	22	1090	3	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q7MG04	2.36e-188	17	1089	17	1025	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
A6TI29	2.95e-187	23	1079	16	1010	Beta-galactosidase 2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=lacZ2 PE=3 SV=1
A7KGA5	2.95e-187	23	1077	16	1008	Beta-galactosidase OS=Klebsiella pneumoniae OX=573 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000733	0.997245	0.001355	0.000234	0.000199	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_04456.