CAZyme Information: MGYG000003252_03179

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_03179
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000003252_303|CGC1	55301.06	5.2429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 26143; End: 27606 Strand: +

Full Sequence      

MAYFGASDAWSMQFIGLWPQEKQKQVADWLFSIENDANGQPKGIGLSLWRFNVGAGSAEQ
GEASQIASPWMRAECFLNPDGTYDWNKQQGQRNFLKLAKERGVNKFLAFLNSPPVYFTQN
GLATNTGRGGTANLKPDCYEKYARFLADVVQGVEEHDSIKFNYICPFNEPDGHWNWVGPK
QEGCPATNREIARTVRLLSKEFVARNIDTQIMVNESSDYRCMFRTHETDWQRGYQIQAFF
CPDSVDTYLGDVPNVPRLMLGHSYWTTTPLSELRNIRCQLRDTLDKHNVDFWQTETCIMG
NDEEIGGGNGYDRTMKTALYVARIIHHDIVYAGAKSWQWWRAIGGDYKDGLIREYTTDDN
FLDGKVEDSKLMWALGNYSRFIRPGAVRLSVSTFDKTGALISDGDTDQLGLMCSAYKNVD
GTYAMVVINYANEEKEFSINEEKVGNAQWQMYRTSDKEGEDLLPVGTVKSGKIVQIPARS
IITLQSR

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	1	484	1.1e-192	0.96900826446281

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.69e-143	1	352	15	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	2.03e-12	84	440	97	406	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	4.05e-07	385	484	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93355.1	0.0	1	487	42	528
ALJ47685.1	0.0	1	487	45	531
QRQ59078.1	0.0	1	487	42	528
SCV07083.1	0.0	1	487	45	531
QUT79243.1	0.0	1	486	42	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	4.45e-91	4	484	22	494	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	9.82e-12	4	429	19	386	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	3.29e-11	4	429	26	393	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	4.16e-10	39	455	18	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
6IUJ_A	6.82e-09	16	481	55	466	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	4.90e-17	4	231	38	268	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	1.05e-11	4	429	43	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_03179.