CAZyme Information: MGYG000003252_01958

Basic Information

• Species: Bacteroides sp900761785
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900761785
• CAZyme ID: MGYG000003252_01958
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000003252_156|CGC4	86228.28	5.4054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003252	8296673	MAG	United States	North America

• Gene Location: Start: 147280; End: 149628 Strand: -

Full Sequence      

MMKRLYILIMAQIVSVQLFAQPSSLQVAYKNPDLSVETRVADLLSRMTLEEKVGQLLCPL
GWEMYEIDGTDVRPSDKFRQLVKERNAGMLWATYRADPWTKKTLENGLNPELAAKAGNAL
QKYVIENTRLGIPVFLAEEAPHGHMAIGTTVFPTGIGMAATWTPELIKEAGQVIAKEIRS
QGGHISYGPVLDLTRDPRWSRVEETFGEDPVLSGILGAAMVAGLGGGNLSQEYATIATLK
HFLAYALPESGQNGNYASIGVRDLHQNFLPPFRQAIDAGALSVMTSYNSIDGVPCTSNHY
LLTQLLRNEWKFRGFVVSDLYSIEGIHESHFVAPTKENAAVQAVTAGVDVDLGGDAYASL
CHAVQSGQVDKAVIDTAVCRVLRMKFEMGLFEQPYVDPKMAAKKVRSRESIELARKIAQA
SITLLENKNSILPLRKDINKIAVIGPNADNQYNMLGDYTAPQEDGNVKTVLDGIVAKLSP
SRVEYVKGCAIRDTTINEIEKAVEAARRSEVVIAVVGGSSARDFKTSYKETGAAVADKGS
ISDMECGEGFDRATLSLLGRQQELLEALKRTGKPLVVVYIEGRPLDKNWPAEYADALLTA
YYPGQEGGNAIADVLFGDYNPAGRLPITIPRSVGQIPVYYNKKAPQNHDYVEMSALPLYA
FGYGLSYTTFEYSDLQVTPTSPCHYEVSFRVENTGKYDGEEVAQLYIRDEYASVVQPMKQ
LKQFERFFLKRGEEKKITFAITENDLSIINQDLRCVVESGDFQIMIGSSSDNIRLNDRIS
VK

Enzyme Prediction     

No EC number prediction in MGYG000003252_01958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	126	352	6.4e-71	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	2	774	1	758	beta-glucosidase BglX.
COG1472	BglX	8.94e-94	47	481	1	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.27e-89	129	767	78	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	4.75e-75	48	384	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.96e-68	422	667	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL36998.1	0.0	1	782	1	782
QGT74048.1	0.0	1	782	1	782
QRQ56310.1	0.0	1	782	1	782
ALJ49535.1	0.0	1	782	1	782
QNL37005.1	0.0	18	782	19	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	6.37e-145	29	776	7	751	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	4.96e-144	29	776	7	751	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.88e-142	29	774	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	3.43e-138	37	770	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.89e-137	37	770	4	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	5.38e-143	14	774	9	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.39e-139	14	774	9	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.01e-133	127	770	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.63e-130	29	770	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q23892	3.83e-102	37	768	77	813	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999143	0.000154	0.000154	0.000142	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003252_01958.